Cargando…
Cardiopulmonary bypass time is an independent risk factor for acute kidney injury in emergent thoracic aortic surgery: a retrospective cohort study
BACKGROUND: Thoracic aortic surgery and cardiopulmonary bypass are both associated with development of postoperative acute kidney injury. In this study, we undertook to investigate the relationship between cardiopulmonary bypass time and postoperative acute kidney injury in patients undergoing thora...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6505293/ https://www.ncbi.nlm.nih.gov/pubmed/31064409 http://dx.doi.org/10.1186/s13019-019-0907-x |
_version_ | 1783416740832608256 |
---|---|
author | Xu, Shijun Liu, Jie Li, Lei Wu, Zining Li, Jiachen Liu, Yongmin Zhu, Junming Sun, Lizhong Guan, Xinliang Gong, Ming Zhang, Hongjia |
author_facet | Xu, Shijun Liu, Jie Li, Lei Wu, Zining Li, Jiachen Liu, Yongmin Zhu, Junming Sun, Lizhong Guan, Xinliang Gong, Ming Zhang, Hongjia |
author_sort | Xu, Shijun |
collection | PubMed |
description | BACKGROUND: Thoracic aortic surgery and cardiopulmonary bypass are both associated with development of postoperative acute kidney injury. In this study, we undertook to investigate the relationship between cardiopulmonary bypass time and postoperative acute kidney injury in patients undergoing thoracic aortic surgery for acute DeBakey Type I aortic dissection. METHODS: All patients receiving thoracic aortic surgery for acute DeBakey Type I aortic dissection in Beijing Anzhen hospital from December 2015 to April 2017 were included. Cardiopulmonary bypass time was recorded during surgery. Acute kidney injury was defined based on the Kidney Disease Improving Global Outcomes criteria. A total of 115 consecutive patients were eventually analyzed. RESULTS: The overall incidence of acute kidney injury was 53.0% (n = 61). The average age was 47.8 ± 10.7 years; 74.8% were male. Mean cardiopulmonary bypass time was 211 ± 56 min. In-hospital mortality was 7.8%. Multivariate logistic regression revealed that cardiopulmonary bypass time was independently associated with the occurrence of postoperative acute kidney injury after adjust confounding factors (odds ratio = 1.171; 95% confidence interval: 1.002–1.368; P = 0.047). CONCLUSIONS: Cardiopulmonary bypass time is independently associated with an increased hazard of acute kidney injury after thoracic aortic surgery for acute DeBakey Type I aortic dissection. Further understanding of the mechanism of this association is crucial to the design of preventative strategies. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13019-019-0907-x) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-6505293 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-65052932019-05-10 Cardiopulmonary bypass time is an independent risk factor for acute kidney injury in emergent thoracic aortic surgery: a retrospective cohort study Xu, Shijun Liu, Jie Li, Lei Wu, Zining Li, Jiachen Liu, Yongmin Zhu, Junming Sun, Lizhong Guan, Xinliang Gong, Ming Zhang, Hongjia J Cardiothorac Surg Research Article BACKGROUND: Thoracic aortic surgery and cardiopulmonary bypass are both associated with development of postoperative acute kidney injury. In this study, we undertook to investigate the relationship between cardiopulmonary bypass time and postoperative acute kidney injury in patients undergoing thoracic aortic surgery for acute DeBakey Type I aortic dissection. METHODS: All patients receiving thoracic aortic surgery for acute DeBakey Type I aortic dissection in Beijing Anzhen hospital from December 2015 to April 2017 were included. Cardiopulmonary bypass time was recorded during surgery. Acute kidney injury was defined based on the Kidney Disease Improving Global Outcomes criteria. A total of 115 consecutive patients were eventually analyzed. RESULTS: The overall incidence of acute kidney injury was 53.0% (n = 61). The average age was 47.8 ± 10.7 years; 74.8% were male. Mean cardiopulmonary bypass time was 211 ± 56 min. In-hospital mortality was 7.8%. Multivariate logistic regression revealed that cardiopulmonary bypass time was independently associated with the occurrence of postoperative acute kidney injury after adjust confounding factors (odds ratio = 1.171; 95% confidence interval: 1.002–1.368; P = 0.047). CONCLUSIONS: Cardiopulmonary bypass time is independently associated with an increased hazard of acute kidney injury after thoracic aortic surgery for acute DeBakey Type I aortic dissection. Further understanding of the mechanism of this association is crucial to the design of preventative strategies. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13019-019-0907-x) contains supplementary material, which is available to authorized users. BioMed Central 2019-05-07 /pmc/articles/PMC6505293/ /pubmed/31064409 http://dx.doi.org/10.1186/s13019-019-0907-x Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Xu, Shijun Liu, Jie Li, Lei Wu, Zining Li, Jiachen Liu, Yongmin Zhu, Junming Sun, Lizhong Guan, Xinliang Gong, Ming Zhang, Hongjia Cardiopulmonary bypass time is an independent risk factor for acute kidney injury in emergent thoracic aortic surgery: a retrospective cohort study |
title | Cardiopulmonary bypass time is an independent risk factor for acute kidney injury in emergent thoracic aortic surgery: a retrospective cohort study |
title_full | Cardiopulmonary bypass time is an independent risk factor for acute kidney injury in emergent thoracic aortic surgery: a retrospective cohort study |
title_fullStr | Cardiopulmonary bypass time is an independent risk factor for acute kidney injury in emergent thoracic aortic surgery: a retrospective cohort study |
title_full_unstemmed | Cardiopulmonary bypass time is an independent risk factor for acute kidney injury in emergent thoracic aortic surgery: a retrospective cohort study |
title_short | Cardiopulmonary bypass time is an independent risk factor for acute kidney injury in emergent thoracic aortic surgery: a retrospective cohort study |
title_sort | cardiopulmonary bypass time is an independent risk factor for acute kidney injury in emergent thoracic aortic surgery: a retrospective cohort study |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6505293/ https://www.ncbi.nlm.nih.gov/pubmed/31064409 http://dx.doi.org/10.1186/s13019-019-0907-x |
work_keys_str_mv | AT xushijun cardiopulmonarybypasstimeisanindependentriskfactorforacutekidneyinjuryinemergentthoracicaorticsurgeryaretrospectivecohortstudy AT liujie cardiopulmonarybypasstimeisanindependentriskfactorforacutekidneyinjuryinemergentthoracicaorticsurgeryaretrospectivecohortstudy AT lilei cardiopulmonarybypasstimeisanindependentriskfactorforacutekidneyinjuryinemergentthoracicaorticsurgeryaretrospectivecohortstudy AT wuzining cardiopulmonarybypasstimeisanindependentriskfactorforacutekidneyinjuryinemergentthoracicaorticsurgeryaretrospectivecohortstudy AT lijiachen cardiopulmonarybypasstimeisanindependentriskfactorforacutekidneyinjuryinemergentthoracicaorticsurgeryaretrospectivecohortstudy AT liuyongmin cardiopulmonarybypasstimeisanindependentriskfactorforacutekidneyinjuryinemergentthoracicaorticsurgeryaretrospectivecohortstudy AT zhujunming cardiopulmonarybypasstimeisanindependentriskfactorforacutekidneyinjuryinemergentthoracicaorticsurgeryaretrospectivecohortstudy AT sunlizhong cardiopulmonarybypasstimeisanindependentriskfactorforacutekidneyinjuryinemergentthoracicaorticsurgeryaretrospectivecohortstudy AT guanxinliang cardiopulmonarybypasstimeisanindependentriskfactorforacutekidneyinjuryinemergentthoracicaorticsurgeryaretrospectivecohortstudy AT gongming cardiopulmonarybypasstimeisanindependentriskfactorforacutekidneyinjuryinemergentthoracicaorticsurgeryaretrospectivecohortstudy AT zhanghongjia cardiopulmonarybypasstimeisanindependentriskfactorforacutekidneyinjuryinemergentthoracicaorticsurgeryaretrospectivecohortstudy |