Cargando…
Cysteine-rich 61 (Cyr61): a biomarker reflecting disease activity in rheumatoid arthritis
BACKGROUND: Numerous preclinical studies have revealed a critical role of cysteine-rich 61 (Cyr61) in the pathogenesis of rheumatoid arthritis (RA). But there is little literature discussing the clinical value of circulation Cyr61 in RA patients. The aim of our study is to investigate the serum Cyr6...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6528265/ https://www.ncbi.nlm.nih.gov/pubmed/31113467 http://dx.doi.org/10.1186/s13075-019-1906-y |
_version_ | 1783420178831245312 |
---|---|
author | Fan, Yong Yang, Xinlei Zhao, Juan Sun, Xiaoying Xie, Wenhui Huang, Yanrong Li, Guangtao Hao, Yanjie Zhang, Zhuoli |
author_facet | Fan, Yong Yang, Xinlei Zhao, Juan Sun, Xiaoying Xie, Wenhui Huang, Yanrong Li, Guangtao Hao, Yanjie Zhang, Zhuoli |
author_sort | Fan, Yong |
collection | PubMed |
description | BACKGROUND: Numerous preclinical studies have revealed a critical role of cysteine-rich 61 (Cyr61) in the pathogenesis of rheumatoid arthritis (RA). But there is little literature discussing the clinical value of circulation Cyr61 in RA patients. The aim of our study is to investigate the serum Cyr61 level and its association with disease activity in RA patients. METHODS: A training cohort was derived from consecutive RA patients who visited our clinic from Jun 2014 to Nov 2018. Serum samples were obtained at the enrollment time. To further confirm discovery, an independent validation cohort was set up based on a registered clinical trial. Paired serum samples of active RA patients were respectively collected at baseline and 12 weeks after uniformed treatment. Serum Cyr61 concentration was detected by enzyme-linked immunosorbent assay. The comparison of Cyr61 between RA patients and controls, the correlation between Cyr61 levels with disease activity, and the change of Cyr61 after treatment were analyzed by appropriate statistical analyses. RESULTS: A total of 177 definite RA patients and 50 age- and gender-matched healthy controls were enrolled in the training cohort. Significantly elevated serum Cyr61 concentration was found in RA patients, demonstrating excellent diagnostic ability to discriminate RA from healthy controls (area under the curve (AUC) = 0.98, P < 0.001). In addition, the Cyr61 level in active RA patients was significantly lower than that in patients in remission/low disease activity, and it was inversely correlated with composite disease activity scores and almost all of the components in statistic. Further study in the validation cohort (n = 77) showed a significant increase of the Cyr61 level at 12 weeks in ACR responders (ACR20/50/70), while no significant change of the Cyr61 level from baseline was observed in non-responders. CONCLUSIONS: Serum Cyr61 levels were remarkably increased in RA patients compared with those in healthy controls. The Cyr61 concentration was inversely correlated with RA disease activity and upregulated in those therapeutic responders. TRIAL REGISTRATION: Combination Therapy Prevents the Relapse of RA, NCT02320630. Registered 19 December 2014, ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13075-019-1906-y) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-6528265 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-65282652019-05-28 Cysteine-rich 61 (Cyr61): a biomarker reflecting disease activity in rheumatoid arthritis Fan, Yong Yang, Xinlei Zhao, Juan Sun, Xiaoying Xie, Wenhui Huang, Yanrong Li, Guangtao Hao, Yanjie Zhang, Zhuoli Arthritis Res Ther Research Article BACKGROUND: Numerous preclinical studies have revealed a critical role of cysteine-rich 61 (Cyr61) in the pathogenesis of rheumatoid arthritis (RA). But there is little literature discussing the clinical value of circulation Cyr61 in RA patients. The aim of our study is to investigate the serum Cyr61 level and its association with disease activity in RA patients. METHODS: A training cohort was derived from consecutive RA patients who visited our clinic from Jun 2014 to Nov 2018. Serum samples were obtained at the enrollment time. To further confirm discovery, an independent validation cohort was set up based on a registered clinical trial. Paired serum samples of active RA patients were respectively collected at baseline and 12 weeks after uniformed treatment. Serum Cyr61 concentration was detected by enzyme-linked immunosorbent assay. The comparison of Cyr61 between RA patients and controls, the correlation between Cyr61 levels with disease activity, and the change of Cyr61 after treatment were analyzed by appropriate statistical analyses. RESULTS: A total of 177 definite RA patients and 50 age- and gender-matched healthy controls were enrolled in the training cohort. Significantly elevated serum Cyr61 concentration was found in RA patients, demonstrating excellent diagnostic ability to discriminate RA from healthy controls (area under the curve (AUC) = 0.98, P < 0.001). In addition, the Cyr61 level in active RA patients was significantly lower than that in patients in remission/low disease activity, and it was inversely correlated with composite disease activity scores and almost all of the components in statistic. Further study in the validation cohort (n = 77) showed a significant increase of the Cyr61 level at 12 weeks in ACR responders (ACR20/50/70), while no significant change of the Cyr61 level from baseline was observed in non-responders. CONCLUSIONS: Serum Cyr61 levels were remarkably increased in RA patients compared with those in healthy controls. The Cyr61 concentration was inversely correlated with RA disease activity and upregulated in those therapeutic responders. TRIAL REGISTRATION: Combination Therapy Prevents the Relapse of RA, NCT02320630. Registered 19 December 2014, ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13075-019-1906-y) contains supplementary material, which is available to authorized users. BioMed Central 2019-05-21 2019 /pmc/articles/PMC6528265/ /pubmed/31113467 http://dx.doi.org/10.1186/s13075-019-1906-y Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Fan, Yong Yang, Xinlei Zhao, Juan Sun, Xiaoying Xie, Wenhui Huang, Yanrong Li, Guangtao Hao, Yanjie Zhang, Zhuoli Cysteine-rich 61 (Cyr61): a biomarker reflecting disease activity in rheumatoid arthritis |
title | Cysteine-rich 61 (Cyr61): a biomarker reflecting disease activity in rheumatoid arthritis |
title_full | Cysteine-rich 61 (Cyr61): a biomarker reflecting disease activity in rheumatoid arthritis |
title_fullStr | Cysteine-rich 61 (Cyr61): a biomarker reflecting disease activity in rheumatoid arthritis |
title_full_unstemmed | Cysteine-rich 61 (Cyr61): a biomarker reflecting disease activity in rheumatoid arthritis |
title_short | Cysteine-rich 61 (Cyr61): a biomarker reflecting disease activity in rheumatoid arthritis |
title_sort | cysteine-rich 61 (cyr61): a biomarker reflecting disease activity in rheumatoid arthritis |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6528265/ https://www.ncbi.nlm.nih.gov/pubmed/31113467 http://dx.doi.org/10.1186/s13075-019-1906-y |
work_keys_str_mv | AT fanyong cysteinerich61cyr61abiomarkerreflectingdiseaseactivityinrheumatoidarthritis AT yangxinlei cysteinerich61cyr61abiomarkerreflectingdiseaseactivityinrheumatoidarthritis AT zhaojuan cysteinerich61cyr61abiomarkerreflectingdiseaseactivityinrheumatoidarthritis AT sunxiaoying cysteinerich61cyr61abiomarkerreflectingdiseaseactivityinrheumatoidarthritis AT xiewenhui cysteinerich61cyr61abiomarkerreflectingdiseaseactivityinrheumatoidarthritis AT huangyanrong cysteinerich61cyr61abiomarkerreflectingdiseaseactivityinrheumatoidarthritis AT liguangtao cysteinerich61cyr61abiomarkerreflectingdiseaseactivityinrheumatoidarthritis AT haoyanjie cysteinerich61cyr61abiomarkerreflectingdiseaseactivityinrheumatoidarthritis AT zhangzhuoli cysteinerich61cyr61abiomarkerreflectingdiseaseactivityinrheumatoidarthritis |