Cargando…

Cysteine-rich 61 (Cyr61): a biomarker reflecting disease activity in rheumatoid arthritis

BACKGROUND: Numerous preclinical studies have revealed a critical role of cysteine-rich 61 (Cyr61) in the pathogenesis of rheumatoid arthritis (RA). But there is little literature discussing the clinical value of circulation Cyr61 in RA patients. The aim of our study is to investigate the serum Cyr6...

Descripción completa

Detalles Bibliográficos
Autores principales: Fan, Yong, Yang, Xinlei, Zhao, Juan, Sun, Xiaoying, Xie, Wenhui, Huang, Yanrong, Li, Guangtao, Hao, Yanjie, Zhang, Zhuoli
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6528265/
https://www.ncbi.nlm.nih.gov/pubmed/31113467
http://dx.doi.org/10.1186/s13075-019-1906-y
_version_ 1783420178831245312
author Fan, Yong
Yang, Xinlei
Zhao, Juan
Sun, Xiaoying
Xie, Wenhui
Huang, Yanrong
Li, Guangtao
Hao, Yanjie
Zhang, Zhuoli
author_facet Fan, Yong
Yang, Xinlei
Zhao, Juan
Sun, Xiaoying
Xie, Wenhui
Huang, Yanrong
Li, Guangtao
Hao, Yanjie
Zhang, Zhuoli
author_sort Fan, Yong
collection PubMed
description BACKGROUND: Numerous preclinical studies have revealed a critical role of cysteine-rich 61 (Cyr61) in the pathogenesis of rheumatoid arthritis (RA). But there is little literature discussing the clinical value of circulation Cyr61 in RA patients. The aim of our study is to investigate the serum Cyr61 level and its association with disease activity in RA patients. METHODS: A training cohort was derived from consecutive RA patients who visited our clinic from Jun 2014 to Nov 2018. Serum samples were obtained at the enrollment time. To further confirm discovery, an independent validation cohort was set up based on a registered clinical trial. Paired serum samples of active RA patients were respectively collected at baseline and 12 weeks after uniformed treatment. Serum Cyr61 concentration was detected by enzyme-linked immunosorbent assay. The comparison of Cyr61 between RA patients and controls, the correlation between Cyr61 levels with disease activity, and the change of Cyr61 after treatment were analyzed by appropriate statistical analyses. RESULTS: A total of 177 definite RA patients and 50 age- and gender-matched healthy controls were enrolled in the training cohort. Significantly elevated serum Cyr61 concentration was found in RA patients, demonstrating excellent diagnostic ability to discriminate RA from healthy controls (area under the curve (AUC) = 0.98, P <  0.001). In addition, the Cyr61 level in active RA patients was significantly lower than that in patients in remission/low disease activity, and it was inversely correlated with composite disease activity scores and almost all of the components in statistic. Further study in the validation cohort (n = 77) showed a significant increase of the Cyr61 level at 12 weeks in ACR responders (ACR20/50/70), while no significant change of the Cyr61 level from baseline was observed in non-responders. CONCLUSIONS: Serum Cyr61 levels were remarkably increased in RA patients compared with those in healthy controls. The Cyr61 concentration was inversely correlated with RA disease activity and upregulated in those therapeutic responders. TRIAL REGISTRATION: Combination Therapy Prevents the Relapse of RA, NCT02320630. Registered 19 December 2014, ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13075-019-1906-y) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-6528265
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-65282652019-05-28 Cysteine-rich 61 (Cyr61): a biomarker reflecting disease activity in rheumatoid arthritis Fan, Yong Yang, Xinlei Zhao, Juan Sun, Xiaoying Xie, Wenhui Huang, Yanrong Li, Guangtao Hao, Yanjie Zhang, Zhuoli Arthritis Res Ther Research Article BACKGROUND: Numerous preclinical studies have revealed a critical role of cysteine-rich 61 (Cyr61) in the pathogenesis of rheumatoid arthritis (RA). But there is little literature discussing the clinical value of circulation Cyr61 in RA patients. The aim of our study is to investigate the serum Cyr61 level and its association with disease activity in RA patients. METHODS: A training cohort was derived from consecutive RA patients who visited our clinic from Jun 2014 to Nov 2018. Serum samples were obtained at the enrollment time. To further confirm discovery, an independent validation cohort was set up based on a registered clinical trial. Paired serum samples of active RA patients were respectively collected at baseline and 12 weeks after uniformed treatment. Serum Cyr61 concentration was detected by enzyme-linked immunosorbent assay. The comparison of Cyr61 between RA patients and controls, the correlation between Cyr61 levels with disease activity, and the change of Cyr61 after treatment were analyzed by appropriate statistical analyses. RESULTS: A total of 177 definite RA patients and 50 age- and gender-matched healthy controls were enrolled in the training cohort. Significantly elevated serum Cyr61 concentration was found in RA patients, demonstrating excellent diagnostic ability to discriminate RA from healthy controls (area under the curve (AUC) = 0.98, P <  0.001). In addition, the Cyr61 level in active RA patients was significantly lower than that in patients in remission/low disease activity, and it was inversely correlated with composite disease activity scores and almost all of the components in statistic. Further study in the validation cohort (n = 77) showed a significant increase of the Cyr61 level at 12 weeks in ACR responders (ACR20/50/70), while no significant change of the Cyr61 level from baseline was observed in non-responders. CONCLUSIONS: Serum Cyr61 levels were remarkably increased in RA patients compared with those in healthy controls. The Cyr61 concentration was inversely correlated with RA disease activity and upregulated in those therapeutic responders. TRIAL REGISTRATION: Combination Therapy Prevents the Relapse of RA, NCT02320630. Registered 19 December 2014, ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13075-019-1906-y) contains supplementary material, which is available to authorized users. BioMed Central 2019-05-21 2019 /pmc/articles/PMC6528265/ /pubmed/31113467 http://dx.doi.org/10.1186/s13075-019-1906-y Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Fan, Yong
Yang, Xinlei
Zhao, Juan
Sun, Xiaoying
Xie, Wenhui
Huang, Yanrong
Li, Guangtao
Hao, Yanjie
Zhang, Zhuoli
Cysteine-rich 61 (Cyr61): a biomarker reflecting disease activity in rheumatoid arthritis
title Cysteine-rich 61 (Cyr61): a biomarker reflecting disease activity in rheumatoid arthritis
title_full Cysteine-rich 61 (Cyr61): a biomarker reflecting disease activity in rheumatoid arthritis
title_fullStr Cysteine-rich 61 (Cyr61): a biomarker reflecting disease activity in rheumatoid arthritis
title_full_unstemmed Cysteine-rich 61 (Cyr61): a biomarker reflecting disease activity in rheumatoid arthritis
title_short Cysteine-rich 61 (Cyr61): a biomarker reflecting disease activity in rheumatoid arthritis
title_sort cysteine-rich 61 (cyr61): a biomarker reflecting disease activity in rheumatoid arthritis
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6528265/
https://www.ncbi.nlm.nih.gov/pubmed/31113467
http://dx.doi.org/10.1186/s13075-019-1906-y
work_keys_str_mv AT fanyong cysteinerich61cyr61abiomarkerreflectingdiseaseactivityinrheumatoidarthritis
AT yangxinlei cysteinerich61cyr61abiomarkerreflectingdiseaseactivityinrheumatoidarthritis
AT zhaojuan cysteinerich61cyr61abiomarkerreflectingdiseaseactivityinrheumatoidarthritis
AT sunxiaoying cysteinerich61cyr61abiomarkerreflectingdiseaseactivityinrheumatoidarthritis
AT xiewenhui cysteinerich61cyr61abiomarkerreflectingdiseaseactivityinrheumatoidarthritis
AT huangyanrong cysteinerich61cyr61abiomarkerreflectingdiseaseactivityinrheumatoidarthritis
AT liguangtao cysteinerich61cyr61abiomarkerreflectingdiseaseactivityinrheumatoidarthritis
AT haoyanjie cysteinerich61cyr61abiomarkerreflectingdiseaseactivityinrheumatoidarthritis
AT zhangzhuoli cysteinerich61cyr61abiomarkerreflectingdiseaseactivityinrheumatoidarthritis