Cargando…
Fish pathogen binding to mucins from Atlantic salmon and Arctic char differs in avidity and specificity and is modulated by fluid velocity
Disease outbreaks are limiting factors for an ethical and economically sustainable aquaculture industry. The first point of contact between a pathogen and a host occurs in the mucus, which covers the epithelial surfaces of the skin, gills and gastrointestinal tract. Increased knowledge on host-patho...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6534294/ https://www.ncbi.nlm.nih.gov/pubmed/31125340 http://dx.doi.org/10.1371/journal.pone.0215583 |
_version_ | 1783421382760071168 |
---|---|
author | Padra, János Tamás Murugan, Abarna V. M. Sundell, Kristina Sundh, Henrik Benktander, John Lindén, Sara K. |
author_facet | Padra, János Tamás Murugan, Abarna V. M. Sundell, Kristina Sundh, Henrik Benktander, John Lindén, Sara K. |
author_sort | Padra, János Tamás |
collection | PubMed |
description | Disease outbreaks are limiting factors for an ethical and economically sustainable aquaculture industry. The first point of contact between a pathogen and a host occurs in the mucus, which covers the epithelial surfaces of the skin, gills and gastrointestinal tract. Increased knowledge on host-pathogen interactions at these primary barriers may contribute to development of disease prevention strategies. The mucus layer is built of highly glycosylated mucins, and mucin glycosylation differs between these epithelial sites. We have previously shown that A. salmonicida binds to Atlantic salmon mucins. Here we demonstrate binding of four additional bacteria, A. hydrophila, V. harveyi, M. viscosa and Y. ruckeri, to mucins from Atlantic salmon and Arctic char. No specific binding could be observed for V. salmonicida to any of the mucin groups. Mucin binding avidity was highest for A. hydrophila and A. salmonicida, followed by V. harveyi, M. viscosa and Y. ruckeri in decreasing order. Four of the pathogens showed highest binding to either gills or intestinal mucins, whereas none of the pathogens had preference for binding to skin mucins. Fluid velocity enhanced binding of intestinal mucins to A. hydrophila and A. salmonicida at 1.5 and 2 cm/s, whereas a velocity of 2 cm/s for skin mucins increased binding of A. salmonicida and decreased binding of A. hydrophila. Binding avidity, specificity and the effect of fluid velocity on binding thus differ between salmonid pathogens and with mucin origin. The results are in line with a model where the short skin mucin glycans contribute to contact with pathogens whereas pathogen binding to mucins with complex glycans aid the removal of pathogens from internal epithelial surfaces. |
format | Online Article Text |
id | pubmed-6534294 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-65342942019-06-05 Fish pathogen binding to mucins from Atlantic salmon and Arctic char differs in avidity and specificity and is modulated by fluid velocity Padra, János Tamás Murugan, Abarna V. M. Sundell, Kristina Sundh, Henrik Benktander, John Lindén, Sara K. PLoS One Research Article Disease outbreaks are limiting factors for an ethical and economically sustainable aquaculture industry. The first point of contact between a pathogen and a host occurs in the mucus, which covers the epithelial surfaces of the skin, gills and gastrointestinal tract. Increased knowledge on host-pathogen interactions at these primary barriers may contribute to development of disease prevention strategies. The mucus layer is built of highly glycosylated mucins, and mucin glycosylation differs between these epithelial sites. We have previously shown that A. salmonicida binds to Atlantic salmon mucins. Here we demonstrate binding of four additional bacteria, A. hydrophila, V. harveyi, M. viscosa and Y. ruckeri, to mucins from Atlantic salmon and Arctic char. No specific binding could be observed for V. salmonicida to any of the mucin groups. Mucin binding avidity was highest for A. hydrophila and A. salmonicida, followed by V. harveyi, M. viscosa and Y. ruckeri in decreasing order. Four of the pathogens showed highest binding to either gills or intestinal mucins, whereas none of the pathogens had preference for binding to skin mucins. Fluid velocity enhanced binding of intestinal mucins to A. hydrophila and A. salmonicida at 1.5 and 2 cm/s, whereas a velocity of 2 cm/s for skin mucins increased binding of A. salmonicida and decreased binding of A. hydrophila. Binding avidity, specificity and the effect of fluid velocity on binding thus differ between salmonid pathogens and with mucin origin. The results are in line with a model where the short skin mucin glycans contribute to contact with pathogens whereas pathogen binding to mucins with complex glycans aid the removal of pathogens from internal epithelial surfaces. Public Library of Science 2019-05-24 /pmc/articles/PMC6534294/ /pubmed/31125340 http://dx.doi.org/10.1371/journal.pone.0215583 Text en © 2019 Padra et al http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. |
spellingShingle | Research Article Padra, János Tamás Murugan, Abarna V. M. Sundell, Kristina Sundh, Henrik Benktander, John Lindén, Sara K. Fish pathogen binding to mucins from Atlantic salmon and Arctic char differs in avidity and specificity and is modulated by fluid velocity |
title | Fish pathogen binding to mucins from Atlantic salmon and Arctic char differs in avidity and specificity and is modulated by fluid velocity |
title_full | Fish pathogen binding to mucins from Atlantic salmon and Arctic char differs in avidity and specificity and is modulated by fluid velocity |
title_fullStr | Fish pathogen binding to mucins from Atlantic salmon and Arctic char differs in avidity and specificity and is modulated by fluid velocity |
title_full_unstemmed | Fish pathogen binding to mucins from Atlantic salmon and Arctic char differs in avidity and specificity and is modulated by fluid velocity |
title_short | Fish pathogen binding to mucins from Atlantic salmon and Arctic char differs in avidity and specificity and is modulated by fluid velocity |
title_sort | fish pathogen binding to mucins from atlantic salmon and arctic char differs in avidity and specificity and is modulated by fluid velocity |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6534294/ https://www.ncbi.nlm.nih.gov/pubmed/31125340 http://dx.doi.org/10.1371/journal.pone.0215583 |
work_keys_str_mv | AT padrajanostamas fishpathogenbindingtomucinsfromatlanticsalmonandarcticchardiffersinavidityandspecificityandismodulatedbyfluidvelocity AT muruganabarnavm fishpathogenbindingtomucinsfromatlanticsalmonandarcticchardiffersinavidityandspecificityandismodulatedbyfluidvelocity AT sundellkristina fishpathogenbindingtomucinsfromatlanticsalmonandarcticchardiffersinavidityandspecificityandismodulatedbyfluidvelocity AT sundhhenrik fishpathogenbindingtomucinsfromatlanticsalmonandarcticchardiffersinavidityandspecificityandismodulatedbyfluidvelocity AT benktanderjohn fishpathogenbindingtomucinsfromatlanticsalmonandarcticchardiffersinavidityandspecificityandismodulatedbyfluidvelocity AT lindensarak fishpathogenbindingtomucinsfromatlanticsalmonandarcticchardiffersinavidityandspecificityandismodulatedbyfluidvelocity |