Cargando…
Vitamin D deficiency increases risk of nephropathy and cardiovascular diseases in Type 2 diabetes mellitus patients
BACKGROUND: Vitamin D (VD) deficiency is associated with insulin function and secretion. It is linked with diabetes mellitus (DM) progression, and complications were also recorded. Therefore, the current study aimed to investigate serum VD level in Type 2 DM (T2DM) patients and its association with...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Wolters Kluwer - Medknow
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6540771/ https://www.ncbi.nlm.nih.gov/pubmed/31160914 http://dx.doi.org/10.4103/jrms.JRMS_303_18 |
_version_ | 1783422684274622464 |
---|---|
author | Aljack, Hala Abdalazeem Abdalla, Mohammed Karrar Idris, Omer Fadl Ismail, Amar Mohamed |
author_facet | Aljack, Hala Abdalazeem Abdalla, Mohammed Karrar Idris, Omer Fadl Ismail, Amar Mohamed |
author_sort | Aljack, Hala Abdalazeem |
collection | PubMed |
description | BACKGROUND: Vitamin D (VD) deficiency is associated with insulin function and secretion. It is linked with diabetes mellitus (DM) progression, and complications were also recorded. Therefore, the current study aimed to investigate serum VD level in Type 2 DM (T2DM) patients and its association with diabetic nephropathy and cardiovascular diseases (CVD). MATERIALS AND METHODS: In this cross-sectional study, 205 patients with Type 2 diabetes age ranged from 39 to 75 years old were enrolled. Serum VD, high-sensitivity C-reactive protein (hs-CRP), and hemoglobin A1c (HbA1c) were measured. In addition, urinary albumin:creatinine ratio (ACR) was estimated. RESULTS: Patients with Type 2 diabetes had a 78.5% VD level <30 ng/m. ACR and hs-CRP levels were significantly increased in patients with diabetes with VD <30 ng/m (P = 0.011 and P = 0.008, respectively). Female had significantly lower VD level than male P < 0.001. Patients exposed to sunlight had significantly higher VD level and lower hs-CRP levels compared with less-exposed, P value (0.001 and <0.001), respectively. Exercise significantly increased VD and decreased ACR levels in DM patients, P value (0.046 and 0.002), respectively. VD was positively associated with age (r = 0.355 P = 0.040) and negatively correlate with BMI (r = −0.502 P = 0.009), duration of disease (r = −0.498 P = 0.003), ACR (r = −0.384 P = 0.015), and HbA1c (r = −0.327 P = 0.032). CONCLUSION: The evidence from this study suggest that patients with Type 2 diabetes with VD deficiency are at higher risk for developing CVD and nephropathy. |
format | Online Article Text |
id | pubmed-6540771 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Wolters Kluwer - Medknow |
record_format | MEDLINE/PubMed |
spelling | pubmed-65407712019-06-03 Vitamin D deficiency increases risk of nephropathy and cardiovascular diseases in Type 2 diabetes mellitus patients Aljack, Hala Abdalazeem Abdalla, Mohammed Karrar Idris, Omer Fadl Ismail, Amar Mohamed J Res Med Sci Original Article BACKGROUND: Vitamin D (VD) deficiency is associated with insulin function and secretion. It is linked with diabetes mellitus (DM) progression, and complications were also recorded. Therefore, the current study aimed to investigate serum VD level in Type 2 DM (T2DM) patients and its association with diabetic nephropathy and cardiovascular diseases (CVD). MATERIALS AND METHODS: In this cross-sectional study, 205 patients with Type 2 diabetes age ranged from 39 to 75 years old were enrolled. Serum VD, high-sensitivity C-reactive protein (hs-CRP), and hemoglobin A1c (HbA1c) were measured. In addition, urinary albumin:creatinine ratio (ACR) was estimated. RESULTS: Patients with Type 2 diabetes had a 78.5% VD level <30 ng/m. ACR and hs-CRP levels were significantly increased in patients with diabetes with VD <30 ng/m (P = 0.011 and P = 0.008, respectively). Female had significantly lower VD level than male P < 0.001. Patients exposed to sunlight had significantly higher VD level and lower hs-CRP levels compared with less-exposed, P value (0.001 and <0.001), respectively. Exercise significantly increased VD and decreased ACR levels in DM patients, P value (0.046 and 0.002), respectively. VD was positively associated with age (r = 0.355 P = 0.040) and negatively correlate with BMI (r = −0.502 P = 0.009), duration of disease (r = −0.498 P = 0.003), ACR (r = −0.384 P = 0.015), and HbA1c (r = −0.327 P = 0.032). CONCLUSION: The evidence from this study suggest that patients with Type 2 diabetes with VD deficiency are at higher risk for developing CVD and nephropathy. Wolters Kluwer - Medknow 2019-05-22 /pmc/articles/PMC6540771/ /pubmed/31160914 http://dx.doi.org/10.4103/jrms.JRMS_303_18 Text en Copyright: © 2019 Journal of Research in Medical Sciences http://creativecommons.org/licenses/by-nc-sa/4.0 This is an open access journal, and articles are distributed under the terms of the Creative Commons Attribution-NonCommercial-ShareAlike 4.0 License, which allows others to remix, tweak, and build upon the work non-commercially, as long as appropriate credit is given and the new creations are licensed under the identical terms. |
spellingShingle | Original Article Aljack, Hala Abdalazeem Abdalla, Mohammed Karrar Idris, Omer Fadl Ismail, Amar Mohamed Vitamin D deficiency increases risk of nephropathy and cardiovascular diseases in Type 2 diabetes mellitus patients |
title | Vitamin D deficiency increases risk of nephropathy and cardiovascular diseases in Type 2 diabetes mellitus patients |
title_full | Vitamin D deficiency increases risk of nephropathy and cardiovascular diseases in Type 2 diabetes mellitus patients |
title_fullStr | Vitamin D deficiency increases risk of nephropathy and cardiovascular diseases in Type 2 diabetes mellitus patients |
title_full_unstemmed | Vitamin D deficiency increases risk of nephropathy and cardiovascular diseases in Type 2 diabetes mellitus patients |
title_short | Vitamin D deficiency increases risk of nephropathy and cardiovascular diseases in Type 2 diabetes mellitus patients |
title_sort | vitamin d deficiency increases risk of nephropathy and cardiovascular diseases in type 2 diabetes mellitus patients |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6540771/ https://www.ncbi.nlm.nih.gov/pubmed/31160914 http://dx.doi.org/10.4103/jrms.JRMS_303_18 |
work_keys_str_mv | AT aljackhalaabdalazeem vitaminddeficiencyincreasesriskofnephropathyandcardiovasculardiseasesintype2diabetesmellituspatients AT abdallamohammedkarrar vitaminddeficiencyincreasesriskofnephropathyandcardiovasculardiseasesintype2diabetesmellituspatients AT idrisomerfadl vitaminddeficiencyincreasesriskofnephropathyandcardiovasculardiseasesintype2diabetesmellituspatients AT ismailamarmohamed vitaminddeficiencyincreasesriskofnephropathyandcardiovasculardiseasesintype2diabetesmellituspatients |