Cargando…

A Novel Candidate Gene Associated With Body Weight in the Pacific White Shrimp Litopenaeus vannamei

Improvements of growth traits are always the focus in selective breeding programs for the Pacific white shrimp Litopenaeus vannamei (L. vannamei). Identification of growth-related genes or markers can contribute to the application of modern breeding technologies, and thus accelerate the genetic impr...

Descripción completa

Detalles Bibliográficos
Autores principales: Wang, Quanchao, Yu, Yang, Zhang, Qian, Zhang, Xiaojun, Yuan, Jianbo, Huang, Hao, Xiang, Jianhai, Li, Fuhua
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6555256/
https://www.ncbi.nlm.nih.gov/pubmed/31214248
http://dx.doi.org/10.3389/fgene.2019.00520
_version_ 1783425121399078912
author Wang, Quanchao
Yu, Yang
Zhang, Qian
Zhang, Xiaojun
Yuan, Jianbo
Huang, Hao
Xiang, Jianhai
Li, Fuhua
author_facet Wang, Quanchao
Yu, Yang
Zhang, Qian
Zhang, Xiaojun
Yuan, Jianbo
Huang, Hao
Xiang, Jianhai
Li, Fuhua
author_sort Wang, Quanchao
collection PubMed
description Improvements of growth traits are always the focus in selective breeding programs for the Pacific white shrimp Litopenaeus vannamei (L. vannamei). Identification of growth-related genes or markers can contribute to the application of modern breeding technologies, and thus accelerate the genetic improvement of growth traits. The aim of this study was to identify the genes and molecular markers associated with the growth traits of L. vannamei. A population of 200 individuals was genotyped using 2b-RAD techniques for genome-wide linkage disequilibrium (LD) analysis and genome-wide association study (GWAS). The results showed that the LD decayed fast in the studied population, which suggest that it is feasible to fine map the growth-related genes with GWAS in L. vannamei. One gene designated as LvSRC, encoding the class C scavenger receptor (SRC), was identified as a growth-related candidate gene by GWAS. Further targeted sequencing of the candidate gene in another population of 322 shrimps revealed that several non-synonymous mutations within LvSRC were significantly associated with the body weight (P < 0.01), and the most significant marker (SRC_24) located in the candidate gene could explain 13% of phenotypic variance. The current results provide not only molecular markers for genetic improvement in L. vannamei, but also new insights for understanding the growth regulation mechanism in penaeid shrimp.
format Online
Article
Text
id pubmed-6555256
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-65552562019-06-18 A Novel Candidate Gene Associated With Body Weight in the Pacific White Shrimp Litopenaeus vannamei Wang, Quanchao Yu, Yang Zhang, Qian Zhang, Xiaojun Yuan, Jianbo Huang, Hao Xiang, Jianhai Li, Fuhua Front Genet Genetics Improvements of growth traits are always the focus in selective breeding programs for the Pacific white shrimp Litopenaeus vannamei (L. vannamei). Identification of growth-related genes or markers can contribute to the application of modern breeding technologies, and thus accelerate the genetic improvement of growth traits. The aim of this study was to identify the genes and molecular markers associated with the growth traits of L. vannamei. A population of 200 individuals was genotyped using 2b-RAD techniques for genome-wide linkage disequilibrium (LD) analysis and genome-wide association study (GWAS). The results showed that the LD decayed fast in the studied population, which suggest that it is feasible to fine map the growth-related genes with GWAS in L. vannamei. One gene designated as LvSRC, encoding the class C scavenger receptor (SRC), was identified as a growth-related candidate gene by GWAS. Further targeted sequencing of the candidate gene in another population of 322 shrimps revealed that several non-synonymous mutations within LvSRC were significantly associated with the body weight (P < 0.01), and the most significant marker (SRC_24) located in the candidate gene could explain 13% of phenotypic variance. The current results provide not only molecular markers for genetic improvement in L. vannamei, but also new insights for understanding the growth regulation mechanism in penaeid shrimp. Frontiers Media S.A. 2019-05-31 /pmc/articles/PMC6555256/ /pubmed/31214248 http://dx.doi.org/10.3389/fgene.2019.00520 Text en Copyright © 2019 Wang, Yu, Zhang, Zhang, Yuan, Huang, Xiang and Li. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Genetics
Wang, Quanchao
Yu, Yang
Zhang, Qian
Zhang, Xiaojun
Yuan, Jianbo
Huang, Hao
Xiang, Jianhai
Li, Fuhua
A Novel Candidate Gene Associated With Body Weight in the Pacific White Shrimp Litopenaeus vannamei
title A Novel Candidate Gene Associated With Body Weight in the Pacific White Shrimp Litopenaeus vannamei
title_full A Novel Candidate Gene Associated With Body Weight in the Pacific White Shrimp Litopenaeus vannamei
title_fullStr A Novel Candidate Gene Associated With Body Weight in the Pacific White Shrimp Litopenaeus vannamei
title_full_unstemmed A Novel Candidate Gene Associated With Body Weight in the Pacific White Shrimp Litopenaeus vannamei
title_short A Novel Candidate Gene Associated With Body Weight in the Pacific White Shrimp Litopenaeus vannamei
title_sort novel candidate gene associated with body weight in the pacific white shrimp litopenaeus vannamei
topic Genetics
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6555256/
https://www.ncbi.nlm.nih.gov/pubmed/31214248
http://dx.doi.org/10.3389/fgene.2019.00520
work_keys_str_mv AT wangquanchao anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei
AT yuyang anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei
AT zhangqian anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei
AT zhangxiaojun anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei
AT yuanjianbo anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei
AT huanghao anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei
AT xiangjianhai anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei
AT lifuhua anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei
AT wangquanchao novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei
AT yuyang novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei
AT zhangqian novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei
AT zhangxiaojun novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei
AT yuanjianbo novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei
AT huanghao novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei
AT xiangjianhai novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei
AT lifuhua novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei