Cargando…
Protective Effects of Licochalcone A Ameliorates Obesity and Non-Alcoholic Fatty Liver Disease Via Promotion of the Sirt-1/AMPK Pathway in Mice Fed a High-Fat Diet
Licochalcone A is a chalcone isolated from Glycyrrhiza uralensis. It showed anti-tumor and anti-inflammatory properties in mice with acute lung injuries and regulated lipid metabolism through the activation of AMP-activated protein kinase (AMPK) in hepatocytes. However, the effects of licochalcone A...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6562591/ https://www.ncbi.nlm.nih.gov/pubmed/31083505 http://dx.doi.org/10.3390/cells8050447 |
_version_ | 1783426336768917504 |
---|---|
author | Liou, Chian-Jiun Lee, Yau-Ker Ting, Nai-Chun Chen, Ya-Ling Shen, Szu-Chuan Wu, Shu-Ju Huang, Wen-Chung |
author_facet | Liou, Chian-Jiun Lee, Yau-Ker Ting, Nai-Chun Chen, Ya-Ling Shen, Szu-Chuan Wu, Shu-Ju Huang, Wen-Chung |
author_sort | Liou, Chian-Jiun |
collection | PubMed |
description | Licochalcone A is a chalcone isolated from Glycyrrhiza uralensis. It showed anti-tumor and anti-inflammatory properties in mice with acute lung injuries and regulated lipid metabolism through the activation of AMP-activated protein kinase (AMPK) in hepatocytes. However, the effects of licochalcone A on reducing weight gain and improving nonalcoholic fatty liver disease (NAFLD) are unclear. Thus, the present study investigated whether licochalcone A ameliorated weight loss and lipid metabolism in the liver of high-fat diet (HFD)-induced obese mice. Male C57BL/6 mice were fed an HFD to induce obesity and NAFLD, and then were injected intraperitoneally with licochalcone A. In another experiment, a fatty liver cell model was established by incubating HepG2 hepatocytes with oleic acid and treating the cells with licochalcone A to evaluate lipid metabolism. Our results demonstrated that HFD-induced obese mice treated with licochalcone A had decreased body weight as well as inguinal and epididymal adipose tissue weights compared with HFD-treated mice. Licochalcone A also ameliorated hepatocyte steatosis and decreased liver tissue weight and lipid droplet accumulation in liver tissue. We also found that licochalcone A significantly regulated serum triglycerides, low-density lipoprotein, and free fatty acids, and decreased the fasting blood glucose value. Furthermore, in vivo and in vitro, licochalcone A significantly decreased expression of the transcription factor of lipogenesis and fatty acid synthase. Licochalcone A activated the sirt-1/AMPK pathway to reduce fatty acid chain synthesis and increased lipolysis and β-oxidation in hepatocytes. Licochalcone A can potentially ameliorate obesity and NAFLD in mice via activation of the sirt1/AMPK pathway. |
format | Online Article Text |
id | pubmed-6562591 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-65625912019-06-17 Protective Effects of Licochalcone A Ameliorates Obesity and Non-Alcoholic Fatty Liver Disease Via Promotion of the Sirt-1/AMPK Pathway in Mice Fed a High-Fat Diet Liou, Chian-Jiun Lee, Yau-Ker Ting, Nai-Chun Chen, Ya-Ling Shen, Szu-Chuan Wu, Shu-Ju Huang, Wen-Chung Cells Article Licochalcone A is a chalcone isolated from Glycyrrhiza uralensis. It showed anti-tumor and anti-inflammatory properties in mice with acute lung injuries and regulated lipid metabolism through the activation of AMP-activated protein kinase (AMPK) in hepatocytes. However, the effects of licochalcone A on reducing weight gain and improving nonalcoholic fatty liver disease (NAFLD) are unclear. Thus, the present study investigated whether licochalcone A ameliorated weight loss and lipid metabolism in the liver of high-fat diet (HFD)-induced obese mice. Male C57BL/6 mice were fed an HFD to induce obesity and NAFLD, and then were injected intraperitoneally with licochalcone A. In another experiment, a fatty liver cell model was established by incubating HepG2 hepatocytes with oleic acid and treating the cells with licochalcone A to evaluate lipid metabolism. Our results demonstrated that HFD-induced obese mice treated with licochalcone A had decreased body weight as well as inguinal and epididymal adipose tissue weights compared with HFD-treated mice. Licochalcone A also ameliorated hepatocyte steatosis and decreased liver tissue weight and lipid droplet accumulation in liver tissue. We also found that licochalcone A significantly regulated serum triglycerides, low-density lipoprotein, and free fatty acids, and decreased the fasting blood glucose value. Furthermore, in vivo and in vitro, licochalcone A significantly decreased expression of the transcription factor of lipogenesis and fatty acid synthase. Licochalcone A activated the sirt-1/AMPK pathway to reduce fatty acid chain synthesis and increased lipolysis and β-oxidation in hepatocytes. Licochalcone A can potentially ameliorate obesity and NAFLD in mice via activation of the sirt1/AMPK pathway. MDPI 2019-05-11 /pmc/articles/PMC6562591/ /pubmed/31083505 http://dx.doi.org/10.3390/cells8050447 Text en © 2019 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Liou, Chian-Jiun Lee, Yau-Ker Ting, Nai-Chun Chen, Ya-Ling Shen, Szu-Chuan Wu, Shu-Ju Huang, Wen-Chung Protective Effects of Licochalcone A Ameliorates Obesity and Non-Alcoholic Fatty Liver Disease Via Promotion of the Sirt-1/AMPK Pathway in Mice Fed a High-Fat Diet |
title | Protective Effects of Licochalcone A Ameliorates Obesity and Non-Alcoholic Fatty Liver Disease Via Promotion of the Sirt-1/AMPK Pathway in Mice Fed a High-Fat Diet |
title_full | Protective Effects of Licochalcone A Ameliorates Obesity and Non-Alcoholic Fatty Liver Disease Via Promotion of the Sirt-1/AMPK Pathway in Mice Fed a High-Fat Diet |
title_fullStr | Protective Effects of Licochalcone A Ameliorates Obesity and Non-Alcoholic Fatty Liver Disease Via Promotion of the Sirt-1/AMPK Pathway in Mice Fed a High-Fat Diet |
title_full_unstemmed | Protective Effects of Licochalcone A Ameliorates Obesity and Non-Alcoholic Fatty Liver Disease Via Promotion of the Sirt-1/AMPK Pathway in Mice Fed a High-Fat Diet |
title_short | Protective Effects of Licochalcone A Ameliorates Obesity and Non-Alcoholic Fatty Liver Disease Via Promotion of the Sirt-1/AMPK Pathway in Mice Fed a High-Fat Diet |
title_sort | protective effects of licochalcone a ameliorates obesity and non-alcoholic fatty liver disease via promotion of the sirt-1/ampk pathway in mice fed a high-fat diet |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6562591/ https://www.ncbi.nlm.nih.gov/pubmed/31083505 http://dx.doi.org/10.3390/cells8050447 |
work_keys_str_mv | AT liouchianjiun protectiveeffectsoflicochalconeaamelioratesobesityandnonalcoholicfattyliverdiseaseviapromotionofthesirt1ampkpathwayinmicefedahighfatdiet AT leeyauker protectiveeffectsoflicochalconeaamelioratesobesityandnonalcoholicfattyliverdiseaseviapromotionofthesirt1ampkpathwayinmicefedahighfatdiet AT tingnaichun protectiveeffectsoflicochalconeaamelioratesobesityandnonalcoholicfattyliverdiseaseviapromotionofthesirt1ampkpathwayinmicefedahighfatdiet AT chenyaling protectiveeffectsoflicochalconeaamelioratesobesityandnonalcoholicfattyliverdiseaseviapromotionofthesirt1ampkpathwayinmicefedahighfatdiet AT shenszuchuan protectiveeffectsoflicochalconeaamelioratesobesityandnonalcoholicfattyliverdiseaseviapromotionofthesirt1ampkpathwayinmicefedahighfatdiet AT wushuju protectiveeffectsoflicochalconeaamelioratesobesityandnonalcoholicfattyliverdiseaseviapromotionofthesirt1ampkpathwayinmicefedahighfatdiet AT huangwenchung protectiveeffectsoflicochalconeaamelioratesobesityandnonalcoholicfattyliverdiseaseviapromotionofthesirt1ampkpathwayinmicefedahighfatdiet |