Cargando…
Clarifications concerning the commentary “Published analysis of contraceptive effectiveness of Daysy and DaysyView app is fatally flawed”
| Autores principales: | , , , , , , , , , , , , , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
BioMed Central
2019
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6572732/ https://www.ncbi.nlm.nih.gov/pubmed/31208442 http://dx.doi.org/10.1186/s12978-019-0746-1 |
| _version_ | 1783427706706198528 |
|---|---|
| author | Koch, Martin C. Lermann, Johannes van de Roemer, Niels Renner, Simone K. Burghaus, Stefanie Hackl, Janina Dittrich, Ralf Kehl, Sven Oppelt, Patricia G. Hildebrandt, Thomas Hack, Caroline C. Pöhls, Uwe G. Renner, Stefan P. Thiel, Falk C. |
| author_facet | Koch, Martin C. Lermann, Johannes van de Roemer, Niels Renner, Simone K. Burghaus, Stefanie Hackl, Janina Dittrich, Ralf Kehl, Sven Oppelt, Patricia G. Hildebrandt, Thomas Hack, Caroline C. Pöhls, Uwe G. Renner, Stefan P. Thiel, Falk C. |
| author_sort | Koch, Martin C. |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-6572732 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2019 |
| publisher | BioMed Central |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-65727322019-06-24 Clarifications concerning the commentary “Published analysis of contraceptive effectiveness of Daysy and DaysyView app is fatally flawed” Koch, Martin C. Lermann, Johannes van de Roemer, Niels Renner, Simone K. Burghaus, Stefanie Hackl, Janina Dittrich, Ralf Kehl, Sven Oppelt, Patricia G. Hildebrandt, Thomas Hack, Caroline C. Pöhls, Uwe G. Renner, Stefan P. Thiel, Falk C. Reprod Health Letter to the Editor BioMed Central 2019-06-17 /pmc/articles/PMC6572732/ /pubmed/31208442 http://dx.doi.org/10.1186/s12978-019-0746-1 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
| spellingShingle | Letter to the Editor Koch, Martin C. Lermann, Johannes van de Roemer, Niels Renner, Simone K. Burghaus, Stefanie Hackl, Janina Dittrich, Ralf Kehl, Sven Oppelt, Patricia G. Hildebrandt, Thomas Hack, Caroline C. Pöhls, Uwe G. Renner, Stefan P. Thiel, Falk C. Clarifications concerning the commentary “Published analysis of contraceptive effectiveness of Daysy and DaysyView app is fatally flawed” |
| title | Clarifications concerning the commentary “Published analysis of contraceptive effectiveness of Daysy and DaysyView app is fatally flawed” |
| title_full | Clarifications concerning the commentary “Published analysis of contraceptive effectiveness of Daysy and DaysyView app is fatally flawed” |
| title_fullStr | Clarifications concerning the commentary “Published analysis of contraceptive effectiveness of Daysy and DaysyView app is fatally flawed” |
| title_full_unstemmed | Clarifications concerning the commentary “Published analysis of contraceptive effectiveness of Daysy and DaysyView app is fatally flawed” |
| title_short | Clarifications concerning the commentary “Published analysis of contraceptive effectiveness of Daysy and DaysyView app is fatally flawed” |
| title_sort | clarifications concerning the commentary “published analysis of contraceptive effectiveness of daysy and daysyview app is fatally flawed” |
| topic | Letter to the Editor |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6572732/ https://www.ncbi.nlm.nih.gov/pubmed/31208442 http://dx.doi.org/10.1186/s12978-019-0746-1 |
| work_keys_str_mv | AT kochmartinc clarificationsconcerningthecommentarypublishedanalysisofcontraceptiveeffectivenessofdaysyanddaysyviewappisfatallyflawed AT lermannjohannes clarificationsconcerningthecommentarypublishedanalysisofcontraceptiveeffectivenessofdaysyanddaysyviewappisfatallyflawed AT vanderoemerniels clarificationsconcerningthecommentarypublishedanalysisofcontraceptiveeffectivenessofdaysyanddaysyviewappisfatallyflawed AT rennersimonek clarificationsconcerningthecommentarypublishedanalysisofcontraceptiveeffectivenessofdaysyanddaysyviewappisfatallyflawed AT burghausstefanie clarificationsconcerningthecommentarypublishedanalysisofcontraceptiveeffectivenessofdaysyanddaysyviewappisfatallyflawed AT hackljanina clarificationsconcerningthecommentarypublishedanalysisofcontraceptiveeffectivenessofdaysyanddaysyviewappisfatallyflawed AT dittrichralf clarificationsconcerningthecommentarypublishedanalysisofcontraceptiveeffectivenessofdaysyanddaysyviewappisfatallyflawed AT kehlsven clarificationsconcerningthecommentarypublishedanalysisofcontraceptiveeffectivenessofdaysyanddaysyviewappisfatallyflawed AT oppeltpatriciag clarificationsconcerningthecommentarypublishedanalysisofcontraceptiveeffectivenessofdaysyanddaysyviewappisfatallyflawed AT hildebrandtthomas clarificationsconcerningthecommentarypublishedanalysisofcontraceptiveeffectivenessofdaysyanddaysyviewappisfatallyflawed AT hackcarolinec clarificationsconcerningthecommentarypublishedanalysisofcontraceptiveeffectivenessofdaysyanddaysyviewappisfatallyflawed AT pohlsuweg clarificationsconcerningthecommentarypublishedanalysisofcontraceptiveeffectivenessofdaysyanddaysyviewappisfatallyflawed AT rennerstefanp clarificationsconcerningthecommentarypublishedanalysisofcontraceptiveeffectivenessofdaysyanddaysyviewappisfatallyflawed AT thielfalkc clarificationsconcerningthecommentarypublishedanalysisofcontraceptiveeffectivenessofdaysyanddaysyviewappisfatallyflawed |