Cargando…
Mixed-lineage leukemia protein 2 suppresses ciliary assembly by the modulation of actin dynamics and vesicle transport
Primary cilia are critically involved in the coordination of diverse signaling pathways and ciliary defects are associated with a variety of human diseases. The past decades have witnessed great progress in the core machinery orchestrating ciliary assembly. However, the upstream epigenetic cues that...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group UK
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6591415/ https://www.ncbi.nlm.nih.gov/pubmed/31263570 http://dx.doi.org/10.1038/s41421-019-0100-3 |
_version_ | 1783429726677762048 |
---|---|
author | Yang, Yang Hao, Huijie Wu, Xiaofan Guo, Song Liu, Yang Ran, Jie Li, Te Li, Dengwen Liu, Min Zhou, Jun |
author_facet | Yang, Yang Hao, Huijie Wu, Xiaofan Guo, Song Liu, Yang Ran, Jie Li, Te Li, Dengwen Liu, Min Zhou, Jun |
author_sort | Yang, Yang |
collection | PubMed |
description | Primary cilia are critically involved in the coordination of diverse signaling pathways and ciliary defects are associated with a variety of human diseases. The past decades have witnessed great progress in the core machinery orchestrating ciliary assembly. However, the upstream epigenetic cues that direct ciliogenesis remain elusive. Herein, we demonstrate that mixed-lineage leukemia protein 2 (MLL2), a histone methyltransferase, plays a negative role in ciliogenesis. RNA-sequencing analysis reveals that the expression of five actin-associated proteins is significantly downregulated in MLL2-depleted cells. Overexpression of these proteins partially rescues ciliary abnormality elicited by MLL2 depletion. Our data also show that actin dynamics is remarkably changed in MLL2-depleted cells, resulting in the impairment of cell adhesion, spreading, and motility. In addition, MLL2 depletion promotes ciliary vesicle trafficking to the basal body in an actin-related manner. Together, these results reveal that MLL2 inhibits ciliogenesis by modulating actin dynamics and vesicle transport, and suggest that alteration of MLL2 may contribute to the pathogenesis of cilium-associated diseases. |
format | Online Article Text |
id | pubmed-6591415 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Nature Publishing Group UK |
record_format | MEDLINE/PubMed |
spelling | pubmed-65914152019-07-01 Mixed-lineage leukemia protein 2 suppresses ciliary assembly by the modulation of actin dynamics and vesicle transport Yang, Yang Hao, Huijie Wu, Xiaofan Guo, Song Liu, Yang Ran, Jie Li, Te Li, Dengwen Liu, Min Zhou, Jun Cell Discov Article Primary cilia are critically involved in the coordination of diverse signaling pathways and ciliary defects are associated with a variety of human diseases. The past decades have witnessed great progress in the core machinery orchestrating ciliary assembly. However, the upstream epigenetic cues that direct ciliogenesis remain elusive. Herein, we demonstrate that mixed-lineage leukemia protein 2 (MLL2), a histone methyltransferase, plays a negative role in ciliogenesis. RNA-sequencing analysis reveals that the expression of five actin-associated proteins is significantly downregulated in MLL2-depleted cells. Overexpression of these proteins partially rescues ciliary abnormality elicited by MLL2 depletion. Our data also show that actin dynamics is remarkably changed in MLL2-depleted cells, resulting in the impairment of cell adhesion, spreading, and motility. In addition, MLL2 depletion promotes ciliary vesicle trafficking to the basal body in an actin-related manner. Together, these results reveal that MLL2 inhibits ciliogenesis by modulating actin dynamics and vesicle transport, and suggest that alteration of MLL2 may contribute to the pathogenesis of cilium-associated diseases. Nature Publishing Group UK 2019-06-25 /pmc/articles/PMC6591415/ /pubmed/31263570 http://dx.doi.org/10.1038/s41421-019-0100-3 Text en © The Author(s) 2019 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/. |
spellingShingle | Article Yang, Yang Hao, Huijie Wu, Xiaofan Guo, Song Liu, Yang Ran, Jie Li, Te Li, Dengwen Liu, Min Zhou, Jun Mixed-lineage leukemia protein 2 suppresses ciliary assembly by the modulation of actin dynamics and vesicle transport |
title | Mixed-lineage leukemia protein 2 suppresses ciliary assembly by the modulation of actin dynamics and vesicle transport |
title_full | Mixed-lineage leukemia protein 2 suppresses ciliary assembly by the modulation of actin dynamics and vesicle transport |
title_fullStr | Mixed-lineage leukemia protein 2 suppresses ciliary assembly by the modulation of actin dynamics and vesicle transport |
title_full_unstemmed | Mixed-lineage leukemia protein 2 suppresses ciliary assembly by the modulation of actin dynamics and vesicle transport |
title_short | Mixed-lineage leukemia protein 2 suppresses ciliary assembly by the modulation of actin dynamics and vesicle transport |
title_sort | mixed-lineage leukemia protein 2 suppresses ciliary assembly by the modulation of actin dynamics and vesicle transport |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6591415/ https://www.ncbi.nlm.nih.gov/pubmed/31263570 http://dx.doi.org/10.1038/s41421-019-0100-3 |
work_keys_str_mv | AT yangyang mixedlineageleukemiaprotein2suppressesciliaryassemblybythemodulationofactindynamicsandvesicletransport AT haohuijie mixedlineageleukemiaprotein2suppressesciliaryassemblybythemodulationofactindynamicsandvesicletransport AT wuxiaofan mixedlineageleukemiaprotein2suppressesciliaryassemblybythemodulationofactindynamicsandvesicletransport AT guosong mixedlineageleukemiaprotein2suppressesciliaryassemblybythemodulationofactindynamicsandvesicletransport AT liuyang mixedlineageleukemiaprotein2suppressesciliaryassemblybythemodulationofactindynamicsandvesicletransport AT ranjie mixedlineageleukemiaprotein2suppressesciliaryassemblybythemodulationofactindynamicsandvesicletransport AT lite mixedlineageleukemiaprotein2suppressesciliaryassemblybythemodulationofactindynamicsandvesicletransport AT lidengwen mixedlineageleukemiaprotein2suppressesciliaryassemblybythemodulationofactindynamicsandvesicletransport AT liumin mixedlineageleukemiaprotein2suppressesciliaryassemblybythemodulationofactindynamicsandvesicletransport AT zhoujun mixedlineageleukemiaprotein2suppressesciliaryassemblybythemodulationofactindynamicsandvesicletransport |