Cargando…
Differences in the cargos and functions of exosomes derived from six cardiac cell types: a systematic review
Exosomes are bilayer membrane vesicles with cargos that contain a variety of surface proteins, markers, lipids, nucleic acids, and noncoding RNAs. Exosomes from different cardiac cells participate in the processes of cell migration, proliferation, apoptosis, hypertrophy, and regeneration, as well as...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6598249/ https://www.ncbi.nlm.nih.gov/pubmed/31248454 http://dx.doi.org/10.1186/s13287-019-1297-7 |
_version_ | 1783430730768973824 |
---|---|
author | Xu, Ming-yue Ye, Zhi-shuai Song, Xian-tao Huang, Rong-chong |
author_facet | Xu, Ming-yue Ye, Zhi-shuai Song, Xian-tao Huang, Rong-chong |
author_sort | Xu, Ming-yue |
collection | PubMed |
description | Exosomes are bilayer membrane vesicles with cargos that contain a variety of surface proteins, markers, lipids, nucleic acids, and noncoding RNAs. Exosomes from different cardiac cells participate in the processes of cell migration, proliferation, apoptosis, hypertrophy, and regeneration, as well as angiogenesis and enhanced cardiac function, which accelerate cardiac repair. In this article, we mainly focused on the exosomes from six main types of cardiac cells, i.e., fibroblasts, cardiomyocytes, endothelial cells, cardiac progenitor cells, adipocytes, and cardiac telocytes. This may be the first article to describe the commonalities and differences in regard to the function and underlying mechanisms of exosomes among six cardiac cell types in cardiovascular disease. |
format | Online Article Text |
id | pubmed-6598249 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-65982492019-07-11 Differences in the cargos and functions of exosomes derived from six cardiac cell types: a systematic review Xu, Ming-yue Ye, Zhi-shuai Song, Xian-tao Huang, Rong-chong Stem Cell Res Ther Review Exosomes are bilayer membrane vesicles with cargos that contain a variety of surface proteins, markers, lipids, nucleic acids, and noncoding RNAs. Exosomes from different cardiac cells participate in the processes of cell migration, proliferation, apoptosis, hypertrophy, and regeneration, as well as angiogenesis and enhanced cardiac function, which accelerate cardiac repair. In this article, we mainly focused on the exosomes from six main types of cardiac cells, i.e., fibroblasts, cardiomyocytes, endothelial cells, cardiac progenitor cells, adipocytes, and cardiac telocytes. This may be the first article to describe the commonalities and differences in regard to the function and underlying mechanisms of exosomes among six cardiac cell types in cardiovascular disease. BioMed Central 2019-06-27 /pmc/articles/PMC6598249/ /pubmed/31248454 http://dx.doi.org/10.1186/s13287-019-1297-7 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Review Xu, Ming-yue Ye, Zhi-shuai Song, Xian-tao Huang, Rong-chong Differences in the cargos and functions of exosomes derived from six cardiac cell types: a systematic review |
title | Differences in the cargos and functions of exosomes derived from six cardiac cell types: a systematic review |
title_full | Differences in the cargos and functions of exosomes derived from six cardiac cell types: a systematic review |
title_fullStr | Differences in the cargos and functions of exosomes derived from six cardiac cell types: a systematic review |
title_full_unstemmed | Differences in the cargos and functions of exosomes derived from six cardiac cell types: a systematic review |
title_short | Differences in the cargos and functions of exosomes derived from six cardiac cell types: a systematic review |
title_sort | differences in the cargos and functions of exosomes derived from six cardiac cell types: a systematic review |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6598249/ https://www.ncbi.nlm.nih.gov/pubmed/31248454 http://dx.doi.org/10.1186/s13287-019-1297-7 |
work_keys_str_mv | AT xumingyue differencesinthecargosandfunctionsofexosomesderivedfromsixcardiaccelltypesasystematicreview AT yezhishuai differencesinthecargosandfunctionsofexosomesderivedfromsixcardiaccelltypesasystematicreview AT songxiantao differencesinthecargosandfunctionsofexosomesderivedfromsixcardiaccelltypesasystematicreview AT huangrongchong differencesinthecargosandfunctionsofexosomesderivedfromsixcardiaccelltypesasystematicreview |