Cargando…

Differences in the cargos and functions of exosomes derived from six cardiac cell types: a systematic review

Exosomes are bilayer membrane vesicles with cargos that contain a variety of surface proteins, markers, lipids, nucleic acids, and noncoding RNAs. Exosomes from different cardiac cells participate in the processes of cell migration, proliferation, apoptosis, hypertrophy, and regeneration, as well as...

Descripción completa

Detalles Bibliográficos
Autores principales: Xu, Ming-yue, Ye, Zhi-shuai, Song, Xian-tao, Huang, Rong-chong
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6598249/
https://www.ncbi.nlm.nih.gov/pubmed/31248454
http://dx.doi.org/10.1186/s13287-019-1297-7
_version_ 1783430730768973824
author Xu, Ming-yue
Ye, Zhi-shuai
Song, Xian-tao
Huang, Rong-chong
author_facet Xu, Ming-yue
Ye, Zhi-shuai
Song, Xian-tao
Huang, Rong-chong
author_sort Xu, Ming-yue
collection PubMed
description Exosomes are bilayer membrane vesicles with cargos that contain a variety of surface proteins, markers, lipids, nucleic acids, and noncoding RNAs. Exosomes from different cardiac cells participate in the processes of cell migration, proliferation, apoptosis, hypertrophy, and regeneration, as well as angiogenesis and enhanced cardiac function, which accelerate cardiac repair. In this article, we mainly focused on the exosomes from six main types of cardiac cells, i.e., fibroblasts, cardiomyocytes, endothelial cells, cardiac progenitor cells, adipocytes, and cardiac telocytes. This may be the first article to describe the commonalities and differences in regard to the function and underlying mechanisms of exosomes among six cardiac cell types in cardiovascular disease.
format Online
Article
Text
id pubmed-6598249
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-65982492019-07-11 Differences in the cargos and functions of exosomes derived from six cardiac cell types: a systematic review Xu, Ming-yue Ye, Zhi-shuai Song, Xian-tao Huang, Rong-chong Stem Cell Res Ther Review Exosomes are bilayer membrane vesicles with cargos that contain a variety of surface proteins, markers, lipids, nucleic acids, and noncoding RNAs. Exosomes from different cardiac cells participate in the processes of cell migration, proliferation, apoptosis, hypertrophy, and regeneration, as well as angiogenesis and enhanced cardiac function, which accelerate cardiac repair. In this article, we mainly focused on the exosomes from six main types of cardiac cells, i.e., fibroblasts, cardiomyocytes, endothelial cells, cardiac progenitor cells, adipocytes, and cardiac telocytes. This may be the first article to describe the commonalities and differences in regard to the function and underlying mechanisms of exosomes among six cardiac cell types in cardiovascular disease. BioMed Central 2019-06-27 /pmc/articles/PMC6598249/ /pubmed/31248454 http://dx.doi.org/10.1186/s13287-019-1297-7 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Review
Xu, Ming-yue
Ye, Zhi-shuai
Song, Xian-tao
Huang, Rong-chong
Differences in the cargos and functions of exosomes derived from six cardiac cell types: a systematic review
title Differences in the cargos and functions of exosomes derived from six cardiac cell types: a systematic review
title_full Differences in the cargos and functions of exosomes derived from six cardiac cell types: a systematic review
title_fullStr Differences in the cargos and functions of exosomes derived from six cardiac cell types: a systematic review
title_full_unstemmed Differences in the cargos and functions of exosomes derived from six cardiac cell types: a systematic review
title_short Differences in the cargos and functions of exosomes derived from six cardiac cell types: a systematic review
title_sort differences in the cargos and functions of exosomes derived from six cardiac cell types: a systematic review
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6598249/
https://www.ncbi.nlm.nih.gov/pubmed/31248454
http://dx.doi.org/10.1186/s13287-019-1297-7
work_keys_str_mv AT xumingyue differencesinthecargosandfunctionsofexosomesderivedfromsixcardiaccelltypesasystematicreview
AT yezhishuai differencesinthecargosandfunctionsofexosomesderivedfromsixcardiaccelltypesasystematicreview
AT songxiantao differencesinthecargosandfunctionsofexosomesderivedfromsixcardiaccelltypesasystematicreview
AT huangrongchong differencesinthecargosandfunctionsofexosomesderivedfromsixcardiaccelltypesasystematicreview