Cargando…

Long-term Surgical and Chemical Castration Deteriorates Memory Function Through Downregulation of PKA/CREB/BDNF and c-Raf/MEK/ERK Pathways in Hippocampus

PURPOSE: Goserelin is a drug used for chemical castration. In a rat model, we investigated whether surgical and chemical castration affected memory ability through the protein kinase A (PKA)/cyclic adenosine monophosphate response element-binding protein (CREB)/brain-derived neurotrophic factor (BDN...

Descripción completa

Detalles Bibliográficos
Autores principales: Shin, Mal-Soon, Kim, Tae-Won, Park, Sang-Seo, Ko, Il-Gyu, Kim, Chang-Ju, Kim, Mia, Roh, Su Yeon, Kim, Kwang Taek, Kim, Khae Hawn
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Korean Continence Society 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6606934/
https://www.ncbi.nlm.nih.gov/pubmed/31260611
http://dx.doi.org/10.5213/inj.1938103.052
_version_ 1783431995310735360
author Shin, Mal-Soon
Kim, Tae-Won
Park, Sang-Seo
Ko, Il-Gyu
Kim, Chang-Ju
Kim, Mia
Roh, Su Yeon
Kim, Kwang Taek
Kim, Khae Hawn
author_facet Shin, Mal-Soon
Kim, Tae-Won
Park, Sang-Seo
Ko, Il-Gyu
Kim, Chang-Ju
Kim, Mia
Roh, Su Yeon
Kim, Kwang Taek
Kim, Khae Hawn
author_sort Shin, Mal-Soon
collection PubMed
description PURPOSE: Goserelin is a drug used for chemical castration. In a rat model, we investigated whether surgical and chemical castration affected memory ability through the protein kinase A (PKA)/cyclic adenosine monophosphate response element-binding protein (CREB)/brain-derived neurotrophic factor (BDNF) and c-Raf/mitogen-activated protein kinases-extracellular signal–regulated kinases (MEK)/extracellular signal–regulated kinases (ERK) pathways in the hippocampus. METHODS: Orchiectomy was performed for surgical castration and goserelin acetate was subcutaneously transplanted into the anterior abdominal wall for chemical castration. Immunohistochemistry was done to quantify neurogenesis. To assess the involvement of the PKA/CREB/BDNF and c-Raf/MEK/ERK pathways in the memory process, western blots were used. RESULTS: The orchiectomy group and the goserelin group showed less neurogenesis and impaired short-term and spatial memory. Phosphorylation of PKA/CREB/BDNF and phosphorylation of c-Raf/MEK/ERK decreased in the orchiectomy and goserelin groups. CONCLUSIONS: Short-term memory and spatial memory were affected by surgical and chemical castration via the PKA/CREB/BDNF and c-Raf/MEK/ERK signaling pathways.
format Online
Article
Text
id pubmed-6606934
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Korean Continence Society
record_format MEDLINE/PubMed
spelling pubmed-66069342019-07-10 Long-term Surgical and Chemical Castration Deteriorates Memory Function Through Downregulation of PKA/CREB/BDNF and c-Raf/MEK/ERK Pathways in Hippocampus Shin, Mal-Soon Kim, Tae-Won Park, Sang-Seo Ko, Il-Gyu Kim, Chang-Ju Kim, Mia Roh, Su Yeon Kim, Kwang Taek Kim, Khae Hawn Int Neurourol J Original Article PURPOSE: Goserelin is a drug used for chemical castration. In a rat model, we investigated whether surgical and chemical castration affected memory ability through the protein kinase A (PKA)/cyclic adenosine monophosphate response element-binding protein (CREB)/brain-derived neurotrophic factor (BDNF) and c-Raf/mitogen-activated protein kinases-extracellular signal–regulated kinases (MEK)/extracellular signal–regulated kinases (ERK) pathways in the hippocampus. METHODS: Orchiectomy was performed for surgical castration and goserelin acetate was subcutaneously transplanted into the anterior abdominal wall for chemical castration. Immunohistochemistry was done to quantify neurogenesis. To assess the involvement of the PKA/CREB/BDNF and c-Raf/MEK/ERK pathways in the memory process, western blots were used. RESULTS: The orchiectomy group and the goserelin group showed less neurogenesis and impaired short-term and spatial memory. Phosphorylation of PKA/CREB/BDNF and phosphorylation of c-Raf/MEK/ERK decreased in the orchiectomy and goserelin groups. CONCLUSIONS: Short-term memory and spatial memory were affected by surgical and chemical castration via the PKA/CREB/BDNF and c-Raf/MEK/ERK signaling pathways. Korean Continence Society 2019-06 2019-06-30 /pmc/articles/PMC6606934/ /pubmed/31260611 http://dx.doi.org/10.5213/inj.1938103.052 Text en Copyright © 2019 Korean Continence Society This is an Open Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/4.0/) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Original Article
Shin, Mal-Soon
Kim, Tae-Won
Park, Sang-Seo
Ko, Il-Gyu
Kim, Chang-Ju
Kim, Mia
Roh, Su Yeon
Kim, Kwang Taek
Kim, Khae Hawn
Long-term Surgical and Chemical Castration Deteriorates Memory Function Through Downregulation of PKA/CREB/BDNF and c-Raf/MEK/ERK Pathways in Hippocampus
title Long-term Surgical and Chemical Castration Deteriorates Memory Function Through Downregulation of PKA/CREB/BDNF and c-Raf/MEK/ERK Pathways in Hippocampus
title_full Long-term Surgical and Chemical Castration Deteriorates Memory Function Through Downregulation of PKA/CREB/BDNF and c-Raf/MEK/ERK Pathways in Hippocampus
title_fullStr Long-term Surgical and Chemical Castration Deteriorates Memory Function Through Downregulation of PKA/CREB/BDNF and c-Raf/MEK/ERK Pathways in Hippocampus
title_full_unstemmed Long-term Surgical and Chemical Castration Deteriorates Memory Function Through Downregulation of PKA/CREB/BDNF and c-Raf/MEK/ERK Pathways in Hippocampus
title_short Long-term Surgical and Chemical Castration Deteriorates Memory Function Through Downregulation of PKA/CREB/BDNF and c-Raf/MEK/ERK Pathways in Hippocampus
title_sort long-term surgical and chemical castration deteriorates memory function through downregulation of pka/creb/bdnf and c-raf/mek/erk pathways in hippocampus
topic Original Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6606934/
https://www.ncbi.nlm.nih.gov/pubmed/31260611
http://dx.doi.org/10.5213/inj.1938103.052
work_keys_str_mv AT shinmalsoon longtermsurgicalandchemicalcastrationdeterioratesmemoryfunctionthroughdownregulationofpkacrebbdnfandcrafmekerkpathwaysinhippocampus
AT kimtaewon longtermsurgicalandchemicalcastrationdeterioratesmemoryfunctionthroughdownregulationofpkacrebbdnfandcrafmekerkpathwaysinhippocampus
AT parksangseo longtermsurgicalandchemicalcastrationdeterioratesmemoryfunctionthroughdownregulationofpkacrebbdnfandcrafmekerkpathwaysinhippocampus
AT koilgyu longtermsurgicalandchemicalcastrationdeterioratesmemoryfunctionthroughdownregulationofpkacrebbdnfandcrafmekerkpathwaysinhippocampus
AT kimchangju longtermsurgicalandchemicalcastrationdeterioratesmemoryfunctionthroughdownregulationofpkacrebbdnfandcrafmekerkpathwaysinhippocampus
AT kimmia longtermsurgicalandchemicalcastrationdeterioratesmemoryfunctionthroughdownregulationofpkacrebbdnfandcrafmekerkpathwaysinhippocampus
AT rohsuyeon longtermsurgicalandchemicalcastrationdeterioratesmemoryfunctionthroughdownregulationofpkacrebbdnfandcrafmekerkpathwaysinhippocampus
AT kimkwangtaek longtermsurgicalandchemicalcastrationdeterioratesmemoryfunctionthroughdownregulationofpkacrebbdnfandcrafmekerkpathwaysinhippocampus
AT kimkhaehawn longtermsurgicalandchemicalcastrationdeterioratesmemoryfunctionthroughdownregulationofpkacrebbdnfandcrafmekerkpathwaysinhippocampus