Cargando…
Do blood eosinophils strictly reflect airway inflammation in COPD? Comparison with asthmatic patients
INTRODUCTION: Airway eosinophilic inflammation is a characteristic of asthmatic patients and of a sub group of COPD subjects. Blood eosinophils are deemed as a good surrogate marker of sputum eosinophilic inflammation; however, controversial data have been published particularly in COPD. The aim of...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6617671/ https://www.ncbi.nlm.nih.gov/pubmed/31291952 http://dx.doi.org/10.1186/s12931-019-1111-1 |
_version_ | 1783433744203382784 |
---|---|
author | Pignatti, Patrizia Visca, Dina Cherubino, Francesca Zampogna, Elisabetta Lucini, Etienne Saderi, Laura Sotgiu, Giovanni Spanevello, Antonio |
author_facet | Pignatti, Patrizia Visca, Dina Cherubino, Francesca Zampogna, Elisabetta Lucini, Etienne Saderi, Laura Sotgiu, Giovanni Spanevello, Antonio |
author_sort | Pignatti, Patrizia |
collection | PubMed |
description | INTRODUCTION: Airway eosinophilic inflammation is a characteristic of asthmatic patients and of a sub group of COPD subjects. Blood eosinophils are deemed as a good surrogate marker of sputum eosinophilic inflammation; however, controversial data have been published particularly in COPD. The aim of our study was to compare blood and sputum eosinophils in COPD and asthmatic patients in “real life”. METHODS: Sputum was induced in stable patients with COPD or asthma with hypertonic saline solution and blood eosinophils were evaluated. Frequency of comorbidities was recorded. Correlations were performed stratifying patients by disease and comorbidities. RESULTS: 146 patients, 57 with COPD and 89 with asthma were evaluated. Blood and sputum eosinophils expressed as percentages were correlated in COPD (rho = 0.40; p = 0.004), but the entity of correlation was lower compared with asthmatic subjects (rho = 0.71; p < 0.0001). When blood eosinophils were expressed as counts the correlation was slightly lower than when expressed as percentages in COPD (rho = 0.35; p = 0.01) and in asthmatic patients (rho = 0.68; p < 0.0001). In COPD patients older than 73 years or with blood eosinophils higher than the median value (210.6 eos/μl), or co-diagnosed with hypertension, ischemic heart disease or atrial fibrillation no correlation between blood and sputum eosinophils was found. However, the effect of ischemic heart disease and atrial fibrillation could be driven by hypertension since most of these patients have this comorbidity. CONCLUSION: Blood eosinophils correlated with sputum eosinophils to a lesser degree in COPD than in asthmatic patients. Older age, high blood eosinophils and hypertension affected the correlation between blood and sputum eosinophils, more studies are needed to evaluate the role of other cardiac comobidities. |
format | Online Article Text |
id | pubmed-6617671 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-66176712019-07-22 Do blood eosinophils strictly reflect airway inflammation in COPD? Comparison with asthmatic patients Pignatti, Patrizia Visca, Dina Cherubino, Francesca Zampogna, Elisabetta Lucini, Etienne Saderi, Laura Sotgiu, Giovanni Spanevello, Antonio Respir Res Research INTRODUCTION: Airway eosinophilic inflammation is a characteristic of asthmatic patients and of a sub group of COPD subjects. Blood eosinophils are deemed as a good surrogate marker of sputum eosinophilic inflammation; however, controversial data have been published particularly in COPD. The aim of our study was to compare blood and sputum eosinophils in COPD and asthmatic patients in “real life”. METHODS: Sputum was induced in stable patients with COPD or asthma with hypertonic saline solution and blood eosinophils were evaluated. Frequency of comorbidities was recorded. Correlations were performed stratifying patients by disease and comorbidities. RESULTS: 146 patients, 57 with COPD and 89 with asthma were evaluated. Blood and sputum eosinophils expressed as percentages were correlated in COPD (rho = 0.40; p = 0.004), but the entity of correlation was lower compared with asthmatic subjects (rho = 0.71; p < 0.0001). When blood eosinophils were expressed as counts the correlation was slightly lower than when expressed as percentages in COPD (rho = 0.35; p = 0.01) and in asthmatic patients (rho = 0.68; p < 0.0001). In COPD patients older than 73 years or with blood eosinophils higher than the median value (210.6 eos/μl), or co-diagnosed with hypertension, ischemic heart disease or atrial fibrillation no correlation between blood and sputum eosinophils was found. However, the effect of ischemic heart disease and atrial fibrillation could be driven by hypertension since most of these patients have this comorbidity. CONCLUSION: Blood eosinophils correlated with sputum eosinophils to a lesser degree in COPD than in asthmatic patients. Older age, high blood eosinophils and hypertension affected the correlation between blood and sputum eosinophils, more studies are needed to evaluate the role of other cardiac comobidities. BioMed Central 2019-07-10 2019 /pmc/articles/PMC6617671/ /pubmed/31291952 http://dx.doi.org/10.1186/s12931-019-1111-1 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Pignatti, Patrizia Visca, Dina Cherubino, Francesca Zampogna, Elisabetta Lucini, Etienne Saderi, Laura Sotgiu, Giovanni Spanevello, Antonio Do blood eosinophils strictly reflect airway inflammation in COPD? Comparison with asthmatic patients |
title | Do blood eosinophils strictly reflect airway inflammation in COPD? Comparison with asthmatic patients |
title_full | Do blood eosinophils strictly reflect airway inflammation in COPD? Comparison with asthmatic patients |
title_fullStr | Do blood eosinophils strictly reflect airway inflammation in COPD? Comparison with asthmatic patients |
title_full_unstemmed | Do blood eosinophils strictly reflect airway inflammation in COPD? Comparison with asthmatic patients |
title_short | Do blood eosinophils strictly reflect airway inflammation in COPD? Comparison with asthmatic patients |
title_sort | do blood eosinophils strictly reflect airway inflammation in copd? comparison with asthmatic patients |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6617671/ https://www.ncbi.nlm.nih.gov/pubmed/31291952 http://dx.doi.org/10.1186/s12931-019-1111-1 |
work_keys_str_mv | AT pignattipatrizia dobloodeosinophilsstrictlyreflectairwayinflammationincopdcomparisonwithasthmaticpatients AT viscadina dobloodeosinophilsstrictlyreflectairwayinflammationincopdcomparisonwithasthmaticpatients AT cherubinofrancesca dobloodeosinophilsstrictlyreflectairwayinflammationincopdcomparisonwithasthmaticpatients AT zampognaelisabetta dobloodeosinophilsstrictlyreflectairwayinflammationincopdcomparisonwithasthmaticpatients AT lucinietienne dobloodeosinophilsstrictlyreflectairwayinflammationincopdcomparisonwithasthmaticpatients AT saderilaura dobloodeosinophilsstrictlyreflectairwayinflammationincopdcomparisonwithasthmaticpatients AT sotgiugiovanni dobloodeosinophilsstrictlyreflectairwayinflammationincopdcomparisonwithasthmaticpatients AT spanevelloantonio dobloodeosinophilsstrictlyreflectairwayinflammationincopdcomparisonwithasthmaticpatients |