Cargando…

A multilevel analysis of the determinants of missed opportunities for vaccination among children attending primary healthcare facilities in Kano, Nigeria: Findings from the pre-implementation phase of a collaborative quality improvement programme

BACKGROUND: We aimed to determine the factors that are responsible for missed opportunities for vaccination (MOV) among children aged 0–23 months attending primary health care (PHC) facilities in Nassarawa, Kano State, Nigeria. METHODS: This cross-sectional study was conducted in the pre-implementat...

Descripción completa

Detalles Bibliográficos
Autores principales: Adamu, Abdu A., Uthman, Olalekan A., Gadanya, Muktar A., Adetokunboh, Olatunji O., Wiysonge, Charles S.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6619653/
https://www.ncbi.nlm.nih.gov/pubmed/31291267
http://dx.doi.org/10.1371/journal.pone.0218572
_version_ 1783433944954306560
author Adamu, Abdu A.
Uthman, Olalekan A.
Gadanya, Muktar A.
Adetokunboh, Olatunji O.
Wiysonge, Charles S.
author_facet Adamu, Abdu A.
Uthman, Olalekan A.
Gadanya, Muktar A.
Adetokunboh, Olatunji O.
Wiysonge, Charles S.
author_sort Adamu, Abdu A.
collection PubMed
description BACKGROUND: We aimed to determine the factors that are responsible for missed opportunities for vaccination (MOV) among children aged 0–23 months attending primary health care (PHC) facilities in Nassarawa, Kano State, Nigeria. METHODS: This cross-sectional study was conducted in the pre-implementation phase of a quality improvement programme. One-stage cluster sampling technique was employed. Data were collected from caregivers of children aged 0–23 months in ten randomly selected PHC facilities in Nassarawa Local Government Area of Kano State. Semi-structured, interviewer administered questionnaires were used. Frequencies and percentages were used to summarize the data. Multilevel logistic regression model with fixed effect and random effect component was fitted to obtain measures of association and variation respectively. RESULTS: Caregivers of 675 children responded. Among these children, the prevalence of MOV (for at least one antigen) was 36.15%. MOV (for individual antigens) was highest for inactivated polio vaccine followed by measles vaccine. The random effect model yielded an intraclass correlation coefficient of 9.60% for the empty model. The fixed effect model revealed that MOV was more likely among children that were accompanying a caregiver to the health facility (OR = 2.86, 95%CrI: 1.28 to 5.80) compared to those that were visiting the health facility for medical consultation. Failure to receive vaccination on the day of health facility visit (OR = 2.32, 95%CrI: 1.12 to 4.12) and visiting a clinic with three or more vaccinators (OR = 12.91, 95%CrI: 4.82 to 27.14) increased the likelihood of MOV. CONCLUSION: The study identified important local factors that are responsible for MOV which can be addressed in the QI programme.
format Online
Article
Text
id pubmed-6619653
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-66196532019-07-25 A multilevel analysis of the determinants of missed opportunities for vaccination among children attending primary healthcare facilities in Kano, Nigeria: Findings from the pre-implementation phase of a collaborative quality improvement programme Adamu, Abdu A. Uthman, Olalekan A. Gadanya, Muktar A. Adetokunboh, Olatunji O. Wiysonge, Charles S. PLoS One Research Article BACKGROUND: We aimed to determine the factors that are responsible for missed opportunities for vaccination (MOV) among children aged 0–23 months attending primary health care (PHC) facilities in Nassarawa, Kano State, Nigeria. METHODS: This cross-sectional study was conducted in the pre-implementation phase of a quality improvement programme. One-stage cluster sampling technique was employed. Data were collected from caregivers of children aged 0–23 months in ten randomly selected PHC facilities in Nassarawa Local Government Area of Kano State. Semi-structured, interviewer administered questionnaires were used. Frequencies and percentages were used to summarize the data. Multilevel logistic regression model with fixed effect and random effect component was fitted to obtain measures of association and variation respectively. RESULTS: Caregivers of 675 children responded. Among these children, the prevalence of MOV (for at least one antigen) was 36.15%. MOV (for individual antigens) was highest for inactivated polio vaccine followed by measles vaccine. The random effect model yielded an intraclass correlation coefficient of 9.60% for the empty model. The fixed effect model revealed that MOV was more likely among children that were accompanying a caregiver to the health facility (OR = 2.86, 95%CrI: 1.28 to 5.80) compared to those that were visiting the health facility for medical consultation. Failure to receive vaccination on the day of health facility visit (OR = 2.32, 95%CrI: 1.12 to 4.12) and visiting a clinic with three or more vaccinators (OR = 12.91, 95%CrI: 4.82 to 27.14) increased the likelihood of MOV. CONCLUSION: The study identified important local factors that are responsible for MOV which can be addressed in the QI programme. Public Library of Science 2019-07-10 /pmc/articles/PMC6619653/ /pubmed/31291267 http://dx.doi.org/10.1371/journal.pone.0218572 Text en © 2019 Adamu et al http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Research Article
Adamu, Abdu A.
Uthman, Olalekan A.
Gadanya, Muktar A.
Adetokunboh, Olatunji O.
Wiysonge, Charles S.
A multilevel analysis of the determinants of missed opportunities for vaccination among children attending primary healthcare facilities in Kano, Nigeria: Findings from the pre-implementation phase of a collaborative quality improvement programme
title A multilevel analysis of the determinants of missed opportunities for vaccination among children attending primary healthcare facilities in Kano, Nigeria: Findings from the pre-implementation phase of a collaborative quality improvement programme
title_full A multilevel analysis of the determinants of missed opportunities for vaccination among children attending primary healthcare facilities in Kano, Nigeria: Findings from the pre-implementation phase of a collaborative quality improvement programme
title_fullStr A multilevel analysis of the determinants of missed opportunities for vaccination among children attending primary healthcare facilities in Kano, Nigeria: Findings from the pre-implementation phase of a collaborative quality improvement programme
title_full_unstemmed A multilevel analysis of the determinants of missed opportunities for vaccination among children attending primary healthcare facilities in Kano, Nigeria: Findings from the pre-implementation phase of a collaborative quality improvement programme
title_short A multilevel analysis of the determinants of missed opportunities for vaccination among children attending primary healthcare facilities in Kano, Nigeria: Findings from the pre-implementation phase of a collaborative quality improvement programme
title_sort multilevel analysis of the determinants of missed opportunities for vaccination among children attending primary healthcare facilities in kano, nigeria: findings from the pre-implementation phase of a collaborative quality improvement programme
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6619653/
https://www.ncbi.nlm.nih.gov/pubmed/31291267
http://dx.doi.org/10.1371/journal.pone.0218572
work_keys_str_mv AT adamuabdua amultilevelanalysisofthedeterminantsofmissedopportunitiesforvaccinationamongchildrenattendingprimaryhealthcarefacilitiesinkanonigeriafindingsfromthepreimplementationphaseofacollaborativequalityimprovementprogramme
AT uthmanolalekana amultilevelanalysisofthedeterminantsofmissedopportunitiesforvaccinationamongchildrenattendingprimaryhealthcarefacilitiesinkanonigeriafindingsfromthepreimplementationphaseofacollaborativequalityimprovementprogramme
AT gadanyamuktara amultilevelanalysisofthedeterminantsofmissedopportunitiesforvaccinationamongchildrenattendingprimaryhealthcarefacilitiesinkanonigeriafindingsfromthepreimplementationphaseofacollaborativequalityimprovementprogramme
AT adetokunboholatunjio amultilevelanalysisofthedeterminantsofmissedopportunitiesforvaccinationamongchildrenattendingprimaryhealthcarefacilitiesinkanonigeriafindingsfromthepreimplementationphaseofacollaborativequalityimprovementprogramme
AT wiysongecharless amultilevelanalysisofthedeterminantsofmissedopportunitiesforvaccinationamongchildrenattendingprimaryhealthcarefacilitiesinkanonigeriafindingsfromthepreimplementationphaseofacollaborativequalityimprovementprogramme
AT adamuabdua multilevelanalysisofthedeterminantsofmissedopportunitiesforvaccinationamongchildrenattendingprimaryhealthcarefacilitiesinkanonigeriafindingsfromthepreimplementationphaseofacollaborativequalityimprovementprogramme
AT uthmanolalekana multilevelanalysisofthedeterminantsofmissedopportunitiesforvaccinationamongchildrenattendingprimaryhealthcarefacilitiesinkanonigeriafindingsfromthepreimplementationphaseofacollaborativequalityimprovementprogramme
AT gadanyamuktara multilevelanalysisofthedeterminantsofmissedopportunitiesforvaccinationamongchildrenattendingprimaryhealthcarefacilitiesinkanonigeriafindingsfromthepreimplementationphaseofacollaborativequalityimprovementprogramme
AT adetokunboholatunjio multilevelanalysisofthedeterminantsofmissedopportunitiesforvaccinationamongchildrenattendingprimaryhealthcarefacilitiesinkanonigeriafindingsfromthepreimplementationphaseofacollaborativequalityimprovementprogramme
AT wiysongecharless multilevelanalysisofthedeterminantsofmissedopportunitiesforvaccinationamongchildrenattendingprimaryhealthcarefacilitiesinkanonigeriafindingsfromthepreimplementationphaseofacollaborativequalityimprovementprogramme