Cargando…

The contexts of heavy drinking: A systematic review of the combinations of context-related factors associated with heavy drinking occasions

BACKGROUND: The amount of alcohol consumed during an occasion can be influenced by physical and social attributes of the setting, characteristics and state of individuals, and the interactions of these components. This systematic review identifies and describes the specific combinations and sequence...

Descripción completa

Detalles Bibliográficos
Autores principales: Stanesby, Oliver, Labhart, Florian, Dietze, Paul, Wright, Cassandra J. C., Kuntsche, Emmanuel
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6619678/
https://www.ncbi.nlm.nih.gov/pubmed/31291261
http://dx.doi.org/10.1371/journal.pone.0218465
_version_ 1783433950308335616
author Stanesby, Oliver
Labhart, Florian
Dietze, Paul
Wright, Cassandra J. C.
Kuntsche, Emmanuel
author_facet Stanesby, Oliver
Labhart, Florian
Dietze, Paul
Wright, Cassandra J. C.
Kuntsche, Emmanuel
author_sort Stanesby, Oliver
collection PubMed
description BACKGROUND: The amount of alcohol consumed during an occasion can be influenced by physical and social attributes of the setting, characteristics and state of individuals, and the interactions of these components. This systematic review identifies and describes the specific combinations and sequences of context-related factors that are associated with heavy drinking occasions. MATERIALS AND METHODS: We conducted a systematic literature search of MEDLINE, Embase and the Cumulative Index to Nursing and Allied Health Literature (CINAHL) databases. Eligible articles were event-level and event-based studies that quantitatively analysed associations of sequences or combinations of context-related factors with event-level alcohol consumption. We extracted information on study design, sample, variables, effect estimates and analytical methods. We compiled a list of combinations and sequences associated with heavier drinking (i.e., ‘risky contexts’) and with lighter drinking (‘protective contexts’). The review protocol was registered with PROSPERO (registration number: CRD42018089500). RESULTS: We screened 1902 retrieved records and identified a final sample of 65 eligible studies. Daily mood, day of week, location and drinking group characteristics are important drivers of whether an individual engages in a heavy drinking occasion. The direction and magnitude of some associations differed by gender, age, personality and motives, such that in particular social or physical contexts, some people may feel compelled to drink more while others are compelled to drink less. Very few sequences of factors were reported as being associated with event-level alcohol consumption. CONCLUSIONS: Contexts or factors are experienced in specific sequences that shape the broader drinking context and influence drinking behaviours and consequences but are under-studied. Event-level studies such as those using ecological momentary assessment can harness new technologies for data collection and analysis to improve understandings of why people engage in heavy drinking. Continued event-level research will facilitate public health interventions and policies that reduce heavy drinking and alcohol-related harms.
format Online
Article
Text
id pubmed-6619678
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-66196782019-07-25 The contexts of heavy drinking: A systematic review of the combinations of context-related factors associated with heavy drinking occasions Stanesby, Oliver Labhart, Florian Dietze, Paul Wright, Cassandra J. C. Kuntsche, Emmanuel PLoS One Research Article BACKGROUND: The amount of alcohol consumed during an occasion can be influenced by physical and social attributes of the setting, characteristics and state of individuals, and the interactions of these components. This systematic review identifies and describes the specific combinations and sequences of context-related factors that are associated with heavy drinking occasions. MATERIALS AND METHODS: We conducted a systematic literature search of MEDLINE, Embase and the Cumulative Index to Nursing and Allied Health Literature (CINAHL) databases. Eligible articles were event-level and event-based studies that quantitatively analysed associations of sequences or combinations of context-related factors with event-level alcohol consumption. We extracted information on study design, sample, variables, effect estimates and analytical methods. We compiled a list of combinations and sequences associated with heavier drinking (i.e., ‘risky contexts’) and with lighter drinking (‘protective contexts’). The review protocol was registered with PROSPERO (registration number: CRD42018089500). RESULTS: We screened 1902 retrieved records and identified a final sample of 65 eligible studies. Daily mood, day of week, location and drinking group characteristics are important drivers of whether an individual engages in a heavy drinking occasion. The direction and magnitude of some associations differed by gender, age, personality and motives, such that in particular social or physical contexts, some people may feel compelled to drink more while others are compelled to drink less. Very few sequences of factors were reported as being associated with event-level alcohol consumption. CONCLUSIONS: Contexts or factors are experienced in specific sequences that shape the broader drinking context and influence drinking behaviours and consequences but are under-studied. Event-level studies such as those using ecological momentary assessment can harness new technologies for data collection and analysis to improve understandings of why people engage in heavy drinking. Continued event-level research will facilitate public health interventions and policies that reduce heavy drinking and alcohol-related harms. Public Library of Science 2019-07-10 /pmc/articles/PMC6619678/ /pubmed/31291261 http://dx.doi.org/10.1371/journal.pone.0218465 Text en © 2019 Stanesby et al http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Research Article
Stanesby, Oliver
Labhart, Florian
Dietze, Paul
Wright, Cassandra J. C.
Kuntsche, Emmanuel
The contexts of heavy drinking: A systematic review of the combinations of context-related factors associated with heavy drinking occasions
title The contexts of heavy drinking: A systematic review of the combinations of context-related factors associated with heavy drinking occasions
title_full The contexts of heavy drinking: A systematic review of the combinations of context-related factors associated with heavy drinking occasions
title_fullStr The contexts of heavy drinking: A systematic review of the combinations of context-related factors associated with heavy drinking occasions
title_full_unstemmed The contexts of heavy drinking: A systematic review of the combinations of context-related factors associated with heavy drinking occasions
title_short The contexts of heavy drinking: A systematic review of the combinations of context-related factors associated with heavy drinking occasions
title_sort contexts of heavy drinking: a systematic review of the combinations of context-related factors associated with heavy drinking occasions
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6619678/
https://www.ncbi.nlm.nih.gov/pubmed/31291261
http://dx.doi.org/10.1371/journal.pone.0218465
work_keys_str_mv AT stanesbyoliver thecontextsofheavydrinkingasystematicreviewofthecombinationsofcontextrelatedfactorsassociatedwithheavydrinkingoccasions
AT labhartflorian thecontextsofheavydrinkingasystematicreviewofthecombinationsofcontextrelatedfactorsassociatedwithheavydrinkingoccasions
AT dietzepaul thecontextsofheavydrinkingasystematicreviewofthecombinationsofcontextrelatedfactorsassociatedwithheavydrinkingoccasions
AT wrightcassandrajc thecontextsofheavydrinkingasystematicreviewofthecombinationsofcontextrelatedfactorsassociatedwithheavydrinkingoccasions
AT kuntscheemmanuel thecontextsofheavydrinkingasystematicreviewofthecombinationsofcontextrelatedfactorsassociatedwithheavydrinkingoccasions
AT stanesbyoliver contextsofheavydrinkingasystematicreviewofthecombinationsofcontextrelatedfactorsassociatedwithheavydrinkingoccasions
AT labhartflorian contextsofheavydrinkingasystematicreviewofthecombinationsofcontextrelatedfactorsassociatedwithheavydrinkingoccasions
AT dietzepaul contextsofheavydrinkingasystematicreviewofthecombinationsofcontextrelatedfactorsassociatedwithheavydrinkingoccasions
AT wrightcassandrajc contextsofheavydrinkingasystematicreviewofthecombinationsofcontextrelatedfactorsassociatedwithheavydrinkingoccasions
AT kuntscheemmanuel contextsofheavydrinkingasystematicreviewofthecombinationsofcontextrelatedfactorsassociatedwithheavydrinkingoccasions