Cargando…

Oxysterol/chitotriosidase based selective screening for Niemann-Pick type C in infantile cholestasis syndrome patients

BACKGROUND: Niemann-Pick disease type C (NP-C) is an inherited neurodegenerative disease (1 per 100 000 newborns) caused by NPC proteins impairment that leads to unesterified cholesterol accumulation in late endosomal/lysosomal compartments. To date the NP-C diagnostics is usually based on cholester...

Descripción completa

Detalles Bibliográficos
Autores principales: Degtyareva, Anna V., Proshlyakova, Tatiana Y., Gautier, Marina S., Degtyarev, Dmitry N., Kamenets, Elena A., Baydakova, Galina V., Rebrikov, Denis V., Zakharova, Ekaterina Y.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6625024/
https://www.ncbi.nlm.nih.gov/pubmed/31296176
http://dx.doi.org/10.1186/s12881-019-0857-0
_version_ 1783434332601319424
author Degtyareva, Anna V.
Proshlyakova, Tatiana Y.
Gautier, Marina S.
Degtyarev, Dmitry N.
Kamenets, Elena A.
Baydakova, Galina V.
Rebrikov, Denis V.
Zakharova, Ekaterina Y.
author_facet Degtyareva, Anna V.
Proshlyakova, Tatiana Y.
Gautier, Marina S.
Degtyarev, Dmitry N.
Kamenets, Elena A.
Baydakova, Galina V.
Rebrikov, Denis V.
Zakharova, Ekaterina Y.
author_sort Degtyareva, Anna V.
collection PubMed
description BACKGROUND: Niemann-Pick disease type C (NP-C) is an inherited neurodegenerative disease (1 per 100 000 newborns) caused by NPC proteins impairment that leads to unesterified cholesterol accumulation in late endosomal/lysosomal compartments. To date the NP-C diagnostics is usually based on cholesterol detection in fibroblasts using an invasive and time-consuming Filipin staining and we need more arguments to widely introduce oxysterols as a biomarkers in NP-C. METHODS: Insofar as NP-C represents about 8% of all infant cholestases, in this prospective observational study we tried to re-assess the specificity plasma oxysterol and chitotriosidase as a biochemical screening markers of NP-C in children with cholestasis syndrome of unknown origin. For 108 patients (aged from 2 weeks to 7 years) the levels of cholestane-3β,5α,6β-triol (C-triol) and chitotriosidase (ChT) were measured. For patients with elevated C-triol and/or ChT the NPC1 and NPC2 genes were Sanger-sequenced and 47 additional genes (from the custom liver damage panel) were NGS-sequenced. RESULTS: Increased C-triol level (> 50 ng/ml) was detected in 4 (of 108) infants with cholestasis syndrome of unknown origin, with following molecular genetic NP-C diagnosis for one patient. Plasma cholesterol significantly correlates with C-triol (p < 0.05). NGS of high C-triol infants identified three patients with mutations in JAG1 (Alagille syndrome) and ABCB11 (Byler disease) genes. Increased ChT activity was detected in 8 (of 108) patients with various aetiologies, including NP-C, Byler disease and biliary atresia. CONCLUSION: Combined analysis of ChT activity and C-triol levels is an effective method for identifying NP-C.
format Online
Article
Text
id pubmed-6625024
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-66250242019-07-23 Oxysterol/chitotriosidase based selective screening for Niemann-Pick type C in infantile cholestasis syndrome patients Degtyareva, Anna V. Proshlyakova, Tatiana Y. Gautier, Marina S. Degtyarev, Dmitry N. Kamenets, Elena A. Baydakova, Galina V. Rebrikov, Denis V. Zakharova, Ekaterina Y. BMC Med Genet Research Article BACKGROUND: Niemann-Pick disease type C (NP-C) is an inherited neurodegenerative disease (1 per 100 000 newborns) caused by NPC proteins impairment that leads to unesterified cholesterol accumulation in late endosomal/lysosomal compartments. To date the NP-C diagnostics is usually based on cholesterol detection in fibroblasts using an invasive and time-consuming Filipin staining and we need more arguments to widely introduce oxysterols as a biomarkers in NP-C. METHODS: Insofar as NP-C represents about 8% of all infant cholestases, in this prospective observational study we tried to re-assess the specificity plasma oxysterol and chitotriosidase as a biochemical screening markers of NP-C in children with cholestasis syndrome of unknown origin. For 108 patients (aged from 2 weeks to 7 years) the levels of cholestane-3β,5α,6β-triol (C-triol) and chitotriosidase (ChT) were measured. For patients with elevated C-triol and/or ChT the NPC1 and NPC2 genes were Sanger-sequenced and 47 additional genes (from the custom liver damage panel) were NGS-sequenced. RESULTS: Increased C-triol level (> 50 ng/ml) was detected in 4 (of 108) infants with cholestasis syndrome of unknown origin, with following molecular genetic NP-C diagnosis for one patient. Plasma cholesterol significantly correlates with C-triol (p < 0.05). NGS of high C-triol infants identified three patients with mutations in JAG1 (Alagille syndrome) and ABCB11 (Byler disease) genes. Increased ChT activity was detected in 8 (of 108) patients with various aetiologies, including NP-C, Byler disease and biliary atresia. CONCLUSION: Combined analysis of ChT activity and C-triol levels is an effective method for identifying NP-C. BioMed Central 2019-07-11 /pmc/articles/PMC6625024/ /pubmed/31296176 http://dx.doi.org/10.1186/s12881-019-0857-0 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Degtyareva, Anna V.
Proshlyakova, Tatiana Y.
Gautier, Marina S.
Degtyarev, Dmitry N.
Kamenets, Elena A.
Baydakova, Galina V.
Rebrikov, Denis V.
Zakharova, Ekaterina Y.
Oxysterol/chitotriosidase based selective screening for Niemann-Pick type C in infantile cholestasis syndrome patients
title Oxysterol/chitotriosidase based selective screening for Niemann-Pick type C in infantile cholestasis syndrome patients
title_full Oxysterol/chitotriosidase based selective screening for Niemann-Pick type C in infantile cholestasis syndrome patients
title_fullStr Oxysterol/chitotriosidase based selective screening for Niemann-Pick type C in infantile cholestasis syndrome patients
title_full_unstemmed Oxysterol/chitotriosidase based selective screening for Niemann-Pick type C in infantile cholestasis syndrome patients
title_short Oxysterol/chitotriosidase based selective screening for Niemann-Pick type C in infantile cholestasis syndrome patients
title_sort oxysterol/chitotriosidase based selective screening for niemann-pick type c in infantile cholestasis syndrome patients
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6625024/
https://www.ncbi.nlm.nih.gov/pubmed/31296176
http://dx.doi.org/10.1186/s12881-019-0857-0
work_keys_str_mv AT degtyarevaannav oxysterolchitotriosidasebasedselectivescreeningforniemannpicktypecininfantilecholestasissyndromepatients
AT proshlyakovatatianay oxysterolchitotriosidasebasedselectivescreeningforniemannpicktypecininfantilecholestasissyndromepatients
AT gautiermarinas oxysterolchitotriosidasebasedselectivescreeningforniemannpicktypecininfantilecholestasissyndromepatients
AT degtyarevdmitryn oxysterolchitotriosidasebasedselectivescreeningforniemannpicktypecininfantilecholestasissyndromepatients
AT kamenetselenaa oxysterolchitotriosidasebasedselectivescreeningforniemannpicktypecininfantilecholestasissyndromepatients
AT baydakovagalinav oxysterolchitotriosidasebasedselectivescreeningforniemannpicktypecininfantilecholestasissyndromepatients
AT rebrikovdenisv oxysterolchitotriosidasebasedselectivescreeningforniemannpicktypecininfantilecholestasissyndromepatients
AT zakharovaekaterinay oxysterolchitotriosidasebasedselectivescreeningforniemannpicktypecininfantilecholestasissyndromepatients