Cargando…
Donor-derived cell-free DNA detects kidney transplant rejection during nivolumab treatment
BACKGROUND: In solid organ transplant (SOT) recipients, transplant rejection during immune checkpoint inhibitor (ICI) treatment for cancer is a clinical problem. Donor-derived cell-free DNA (dd-cfDNA) can be detected in blood and is a sensitive biomarker for diagnosis of acute rejection in SOT recip...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6626432/ https://www.ncbi.nlm.nih.gov/pubmed/31300068 http://dx.doi.org/10.1186/s40425-019-0653-6 |
_version_ | 1783434577566498816 |
---|---|
author | Hurkmans, Daan P. Verhoeven, Jeroen G. H. P. de Leur, Kitty Boer, Karin Joosse, Arjen Baan, Carla C. von der Thüsen, Jan H. van Schaik, Ron H. N. Mathijssen, Ron H. J. van der Veldt, Astrid A. M. Hesselink, Dennis A. |
author_facet | Hurkmans, Daan P. Verhoeven, Jeroen G. H. P. de Leur, Kitty Boer, Karin Joosse, Arjen Baan, Carla C. von der Thüsen, Jan H. van Schaik, Ron H. N. Mathijssen, Ron H. J. van der Veldt, Astrid A. M. Hesselink, Dennis A. |
author_sort | Hurkmans, Daan P. |
collection | PubMed |
description | BACKGROUND: In solid organ transplant (SOT) recipients, transplant rejection during immune checkpoint inhibitor (ICI) treatment for cancer is a clinical problem. Donor-derived cell-free DNA (dd-cfDNA) can be detected in blood and is a sensitive biomarker for diagnosis of acute rejection in SOT recipients. To our best knowledge, this is the first case report of a kidney transplant recipient with advanced cancer treated with ICI who was monitored with dd-cfDNA. CASE PRESENTATION: A 72-year old female with a long-standing renal transplant was diagnosed with advanced melanoma in 2018 and was treated with the anti-PD1 antibody nivolumab. Within 12 days after the first administration of nivolumab, dd-cfDNA ratio increased to 23%, suggesting allograft rejection. Her kidney transplant function deteriorated and acute rejection was confirmed by renal transplant biopsy. As the rejection could not be controlled despite immunosuppressive treatment, a transplant nephrectomy was necessary and haemodialysis was started. Immunological analysis of the renal explant showed infiltration of alloreactive, nivolumab-saturated, PD1+ cytotoxic T cells. After transplant nephrectomy, she experienced nivolumab-related toxicity and rapid disease progression. CONCLUSION: Clinicians prescribing ICIs should be aware that SOT recipients are at risk of transplant rejection as a result of T cell activation. Dd-cfDNA is a sensitive biomarker and should be further studied for early detection of transplant rejection. Immunological analysis of the kidney explant showed marked graft infiltration with alloreactive PD-1(+) cytotoxic T cells that were saturated with nivolumab. |
format | Online Article Text |
id | pubmed-6626432 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-66264322019-07-23 Donor-derived cell-free DNA detects kidney transplant rejection during nivolumab treatment Hurkmans, Daan P. Verhoeven, Jeroen G. H. P. de Leur, Kitty Boer, Karin Joosse, Arjen Baan, Carla C. von der Thüsen, Jan H. van Schaik, Ron H. N. Mathijssen, Ron H. J. van der Veldt, Astrid A. M. Hesselink, Dennis A. J Immunother Cancer Case Report BACKGROUND: In solid organ transplant (SOT) recipients, transplant rejection during immune checkpoint inhibitor (ICI) treatment for cancer is a clinical problem. Donor-derived cell-free DNA (dd-cfDNA) can be detected in blood and is a sensitive biomarker for diagnosis of acute rejection in SOT recipients. To our best knowledge, this is the first case report of a kidney transplant recipient with advanced cancer treated with ICI who was monitored with dd-cfDNA. CASE PRESENTATION: A 72-year old female with a long-standing renal transplant was diagnosed with advanced melanoma in 2018 and was treated with the anti-PD1 antibody nivolumab. Within 12 days after the first administration of nivolumab, dd-cfDNA ratio increased to 23%, suggesting allograft rejection. Her kidney transplant function deteriorated and acute rejection was confirmed by renal transplant biopsy. As the rejection could not be controlled despite immunosuppressive treatment, a transplant nephrectomy was necessary and haemodialysis was started. Immunological analysis of the renal explant showed infiltration of alloreactive, nivolumab-saturated, PD1+ cytotoxic T cells. After transplant nephrectomy, she experienced nivolumab-related toxicity and rapid disease progression. CONCLUSION: Clinicians prescribing ICIs should be aware that SOT recipients are at risk of transplant rejection as a result of T cell activation. Dd-cfDNA is a sensitive biomarker and should be further studied for early detection of transplant rejection. Immunological analysis of the kidney explant showed marked graft infiltration with alloreactive PD-1(+) cytotoxic T cells that were saturated with nivolumab. BioMed Central 2019-07-12 /pmc/articles/PMC6626432/ /pubmed/31300068 http://dx.doi.org/10.1186/s40425-019-0653-6 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Case Report Hurkmans, Daan P. Verhoeven, Jeroen G. H. P. de Leur, Kitty Boer, Karin Joosse, Arjen Baan, Carla C. von der Thüsen, Jan H. van Schaik, Ron H. N. Mathijssen, Ron H. J. van der Veldt, Astrid A. M. Hesselink, Dennis A. Donor-derived cell-free DNA detects kidney transplant rejection during nivolumab treatment |
title | Donor-derived cell-free DNA detects kidney transplant rejection during nivolumab treatment |
title_full | Donor-derived cell-free DNA detects kidney transplant rejection during nivolumab treatment |
title_fullStr | Donor-derived cell-free DNA detects kidney transplant rejection during nivolumab treatment |
title_full_unstemmed | Donor-derived cell-free DNA detects kidney transplant rejection during nivolumab treatment |
title_short | Donor-derived cell-free DNA detects kidney transplant rejection during nivolumab treatment |
title_sort | donor-derived cell-free dna detects kidney transplant rejection during nivolumab treatment |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6626432/ https://www.ncbi.nlm.nih.gov/pubmed/31300068 http://dx.doi.org/10.1186/s40425-019-0653-6 |
work_keys_str_mv | AT hurkmansdaanp donorderivedcellfreednadetectskidneytransplantrejectionduringnivolumabtreatment AT verhoevenjeroenghp donorderivedcellfreednadetectskidneytransplantrejectionduringnivolumabtreatment AT deleurkitty donorderivedcellfreednadetectskidneytransplantrejectionduringnivolumabtreatment AT boerkarin donorderivedcellfreednadetectskidneytransplantrejectionduringnivolumabtreatment AT joossearjen donorderivedcellfreednadetectskidneytransplantrejectionduringnivolumabtreatment AT baancarlac donorderivedcellfreednadetectskidneytransplantrejectionduringnivolumabtreatment AT vonderthusenjanh donorderivedcellfreednadetectskidneytransplantrejectionduringnivolumabtreatment AT vanschaikronhn donorderivedcellfreednadetectskidneytransplantrejectionduringnivolumabtreatment AT mathijssenronhj donorderivedcellfreednadetectskidneytransplantrejectionduringnivolumabtreatment AT vanderveldtastridam donorderivedcellfreednadetectskidneytransplantrejectionduringnivolumabtreatment AT hesselinkdennisa donorderivedcellfreednadetectskidneytransplantrejectionduringnivolumabtreatment |