Cargando…

Donor-derived cell-free DNA detects kidney transplant rejection during nivolumab treatment

BACKGROUND: In solid organ transplant (SOT) recipients, transplant rejection during immune checkpoint inhibitor (ICI) treatment for cancer is a clinical problem. Donor-derived cell-free DNA (dd-cfDNA) can be detected in blood and is a sensitive biomarker for diagnosis of acute rejection in SOT recip...

Descripción completa

Detalles Bibliográficos
Autores principales: Hurkmans, Daan P., Verhoeven, Jeroen G. H. P., de Leur, Kitty, Boer, Karin, Joosse, Arjen, Baan, Carla C., von der Thüsen, Jan H., van Schaik, Ron H. N., Mathijssen, Ron H. J., van der Veldt, Astrid A. M., Hesselink, Dennis A.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6626432/
https://www.ncbi.nlm.nih.gov/pubmed/31300068
http://dx.doi.org/10.1186/s40425-019-0653-6
_version_ 1783434577566498816
author Hurkmans, Daan P.
Verhoeven, Jeroen G. H. P.
de Leur, Kitty
Boer, Karin
Joosse, Arjen
Baan, Carla C.
von der Thüsen, Jan H.
van Schaik, Ron H. N.
Mathijssen, Ron H. J.
van der Veldt, Astrid A. M.
Hesselink, Dennis A.
author_facet Hurkmans, Daan P.
Verhoeven, Jeroen G. H. P.
de Leur, Kitty
Boer, Karin
Joosse, Arjen
Baan, Carla C.
von der Thüsen, Jan H.
van Schaik, Ron H. N.
Mathijssen, Ron H. J.
van der Veldt, Astrid A. M.
Hesselink, Dennis A.
author_sort Hurkmans, Daan P.
collection PubMed
description BACKGROUND: In solid organ transplant (SOT) recipients, transplant rejection during immune checkpoint inhibitor (ICI) treatment for cancer is a clinical problem. Donor-derived cell-free DNA (dd-cfDNA) can be detected in blood and is a sensitive biomarker for diagnosis of acute rejection in SOT recipients. To our best knowledge, this is the first case report of a kidney transplant recipient with advanced cancer treated with ICI who was monitored with dd-cfDNA. CASE PRESENTATION: A 72-year old female with a long-standing renal transplant was diagnosed with advanced melanoma in 2018 and was treated with the anti-PD1 antibody nivolumab. Within 12 days after the first administration of nivolumab, dd-cfDNA ratio increased to 23%, suggesting allograft rejection. Her kidney transplant function deteriorated and acute rejection was confirmed by renal transplant biopsy. As the rejection could not be controlled despite immunosuppressive treatment, a transplant nephrectomy was necessary and haemodialysis was started. Immunological analysis of the renal explant showed infiltration of alloreactive, nivolumab-saturated, PD1+ cytotoxic T cells. After transplant nephrectomy, she experienced nivolumab-related toxicity and rapid disease progression. CONCLUSION: Clinicians prescribing ICIs should be aware that SOT recipients are at risk of transplant rejection as a result of T cell activation. Dd-cfDNA is a sensitive biomarker and should be further studied for early detection of transplant rejection. Immunological analysis of the kidney explant showed marked graft infiltration with alloreactive PD-1(+) cytotoxic T cells that were saturated with nivolumab.
format Online
Article
Text
id pubmed-6626432
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-66264322019-07-23 Donor-derived cell-free DNA detects kidney transplant rejection during nivolumab treatment Hurkmans, Daan P. Verhoeven, Jeroen G. H. P. de Leur, Kitty Boer, Karin Joosse, Arjen Baan, Carla C. von der Thüsen, Jan H. van Schaik, Ron H. N. Mathijssen, Ron H. J. van der Veldt, Astrid A. M. Hesselink, Dennis A. J Immunother Cancer Case Report BACKGROUND: In solid organ transplant (SOT) recipients, transplant rejection during immune checkpoint inhibitor (ICI) treatment for cancer is a clinical problem. Donor-derived cell-free DNA (dd-cfDNA) can be detected in blood and is a sensitive biomarker for diagnosis of acute rejection in SOT recipients. To our best knowledge, this is the first case report of a kidney transplant recipient with advanced cancer treated with ICI who was monitored with dd-cfDNA. CASE PRESENTATION: A 72-year old female with a long-standing renal transplant was diagnosed with advanced melanoma in 2018 and was treated with the anti-PD1 antibody nivolumab. Within 12 days after the first administration of nivolumab, dd-cfDNA ratio increased to 23%, suggesting allograft rejection. Her kidney transplant function deteriorated and acute rejection was confirmed by renal transplant biopsy. As the rejection could not be controlled despite immunosuppressive treatment, a transplant nephrectomy was necessary and haemodialysis was started. Immunological analysis of the renal explant showed infiltration of alloreactive, nivolumab-saturated, PD1+ cytotoxic T cells. After transplant nephrectomy, she experienced nivolumab-related toxicity and rapid disease progression. CONCLUSION: Clinicians prescribing ICIs should be aware that SOT recipients are at risk of transplant rejection as a result of T cell activation. Dd-cfDNA is a sensitive biomarker and should be further studied for early detection of transplant rejection. Immunological analysis of the kidney explant showed marked graft infiltration with alloreactive PD-1(+) cytotoxic T cells that were saturated with nivolumab. BioMed Central 2019-07-12 /pmc/articles/PMC6626432/ /pubmed/31300068 http://dx.doi.org/10.1186/s40425-019-0653-6 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Case Report
Hurkmans, Daan P.
Verhoeven, Jeroen G. H. P.
de Leur, Kitty
Boer, Karin
Joosse, Arjen
Baan, Carla C.
von der Thüsen, Jan H.
van Schaik, Ron H. N.
Mathijssen, Ron H. J.
van der Veldt, Astrid A. M.
Hesselink, Dennis A.
Donor-derived cell-free DNA detects kidney transplant rejection during nivolumab treatment
title Donor-derived cell-free DNA detects kidney transplant rejection during nivolumab treatment
title_full Donor-derived cell-free DNA detects kidney transplant rejection during nivolumab treatment
title_fullStr Donor-derived cell-free DNA detects kidney transplant rejection during nivolumab treatment
title_full_unstemmed Donor-derived cell-free DNA detects kidney transplant rejection during nivolumab treatment
title_short Donor-derived cell-free DNA detects kidney transplant rejection during nivolumab treatment
title_sort donor-derived cell-free dna detects kidney transplant rejection during nivolumab treatment
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6626432/
https://www.ncbi.nlm.nih.gov/pubmed/31300068
http://dx.doi.org/10.1186/s40425-019-0653-6
work_keys_str_mv AT hurkmansdaanp donorderivedcellfreednadetectskidneytransplantrejectionduringnivolumabtreatment
AT verhoevenjeroenghp donorderivedcellfreednadetectskidneytransplantrejectionduringnivolumabtreatment
AT deleurkitty donorderivedcellfreednadetectskidneytransplantrejectionduringnivolumabtreatment
AT boerkarin donorderivedcellfreednadetectskidneytransplantrejectionduringnivolumabtreatment
AT joossearjen donorderivedcellfreednadetectskidneytransplantrejectionduringnivolumabtreatment
AT baancarlac donorderivedcellfreednadetectskidneytransplantrejectionduringnivolumabtreatment
AT vonderthusenjanh donorderivedcellfreednadetectskidneytransplantrejectionduringnivolumabtreatment
AT vanschaikronhn donorderivedcellfreednadetectskidneytransplantrejectionduringnivolumabtreatment
AT mathijssenronhj donorderivedcellfreednadetectskidneytransplantrejectionduringnivolumabtreatment
AT vanderveldtastridam donorderivedcellfreednadetectskidneytransplantrejectionduringnivolumabtreatment
AT hesselinkdennisa donorderivedcellfreednadetectskidneytransplantrejectionduringnivolumabtreatment