Cargando…
Identification and functional analysis of GCK gene mutations in 12 Chinese families with hyperglycemia
AIMS/INTRODUCTION: To investigate the clinical and genetic characteristics of Chinese patients with a phenotype consistent with maturity‐onset diabetes of the young type 2 and explore the pathogenic mechanism of their hyperglycemia. MATERIALS AND METHODS: We studied 12 probands and their extended fa...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
John Wiley and Sons Inc.
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6626954/ https://www.ncbi.nlm.nih.gov/pubmed/30592380 http://dx.doi.org/10.1111/jdi.13001 |
_version_ | 1783434629334695936 |
---|---|
author | Wang, Zhixin Diao, Chengming Liu, Yijing Li, Mingmin Zheng, Jia Zhang, Qian Yu, Miao Zhang, Huabing Ping, Fan Li, Ming Xiao, Xinhua |
author_facet | Wang, Zhixin Diao, Chengming Liu, Yijing Li, Mingmin Zheng, Jia Zhang, Qian Yu, Miao Zhang, Huabing Ping, Fan Li, Ming Xiao, Xinhua |
author_sort | Wang, Zhixin |
collection | PubMed |
description | AIMS/INTRODUCTION: To investigate the clinical and genetic characteristics of Chinese patients with a phenotype consistent with maturity‐onset diabetes of the young type 2 and explore the pathogenic mechanism of their hyperglycemia. MATERIALS AND METHODS: We studied 12 probands and their extended families referred to our center for screening mutations in the glucokinase gene (GCK). Clinical data were collected and genetic analysis was carried out. The recombinant wild‐type and mutant glucokinase were generated in Escherichia coli. The kinetic parameters and thermal stability of the enzymes were determined in vitro. RESULTS: In the 12 families, 11 GCK mutations (R43C, T168A, K169N, R191W, Y215X, E221K, M235T, R250H, W257X, G261R and A379E) and one variant of uncertain significance (R275H) were identified. R191W was detected in two unrelated families. Of the 11 GCK mutations, three mutations (c.507G>C, K169N; c.645C>A, Y215X; c.771G>A, W257X; NM_000162.3, NP_000153.1) are novel. Basic kinetics analysis explained the pathogenicity of the five mutants (R43C, K169N, R191W, E221K and A379E), which showed reduced enzyme activity with relative activity indexes between ~0.001 and 0.5 compared with the wild‐type (1.0). In addition, the thermal stabilities of these five mutants were also decreased to varying degrees. However, for R250H and R275H, there was no significant difference in the enzyme activity and thermal stability between the mutants and the wild type. CONCLUSIONS: We have identified 11 GCK mutations and one variant of uncertain significance in 12 Chinese families with hyperglycemia. For five GCK mutations (R43C, K169N, R191W, E221K and A379E), the changes in enzyme kinetics and thermostability might be the pathogenic mechanisms by which mutations cause hyperglycemia. |
format | Online Article Text |
id | pubmed-6626954 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | John Wiley and Sons Inc. |
record_format | MEDLINE/PubMed |
spelling | pubmed-66269542019-07-17 Identification and functional analysis of GCK gene mutations in 12 Chinese families with hyperglycemia Wang, Zhixin Diao, Chengming Liu, Yijing Li, Mingmin Zheng, Jia Zhang, Qian Yu, Miao Zhang, Huabing Ping, Fan Li, Ming Xiao, Xinhua J Diabetes Investig Articles AIMS/INTRODUCTION: To investigate the clinical and genetic characteristics of Chinese patients with a phenotype consistent with maturity‐onset diabetes of the young type 2 and explore the pathogenic mechanism of their hyperglycemia. MATERIALS AND METHODS: We studied 12 probands and their extended families referred to our center for screening mutations in the glucokinase gene (GCK). Clinical data were collected and genetic analysis was carried out. The recombinant wild‐type and mutant glucokinase were generated in Escherichia coli. The kinetic parameters and thermal stability of the enzymes were determined in vitro. RESULTS: In the 12 families, 11 GCK mutations (R43C, T168A, K169N, R191W, Y215X, E221K, M235T, R250H, W257X, G261R and A379E) and one variant of uncertain significance (R275H) were identified. R191W was detected in two unrelated families. Of the 11 GCK mutations, three mutations (c.507G>C, K169N; c.645C>A, Y215X; c.771G>A, W257X; NM_000162.3, NP_000153.1) are novel. Basic kinetics analysis explained the pathogenicity of the five mutants (R43C, K169N, R191W, E221K and A379E), which showed reduced enzyme activity with relative activity indexes between ~0.001 and 0.5 compared with the wild‐type (1.0). In addition, the thermal stabilities of these five mutants were also decreased to varying degrees. However, for R250H and R275H, there was no significant difference in the enzyme activity and thermal stability between the mutants and the wild type. CONCLUSIONS: We have identified 11 GCK mutations and one variant of uncertain significance in 12 Chinese families with hyperglycemia. For five GCK mutations (R43C, K169N, R191W, E221K and A379E), the changes in enzyme kinetics and thermostability might be the pathogenic mechanisms by which mutations cause hyperglycemia. John Wiley and Sons Inc. 2019-02-01 2019-07 /pmc/articles/PMC6626954/ /pubmed/30592380 http://dx.doi.org/10.1111/jdi.13001 Text en © 2018 The Authors. Journal of Diabetes Investigation published by Asian Association for the Study of Diabetes (AASD) and John Wiley & Sons Australia, Ltd This is an open access article under the terms of the http://creativecommons.org/licenses/by-nc/4.0/ License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited and is not used for commercial purposes. |
spellingShingle | Articles Wang, Zhixin Diao, Chengming Liu, Yijing Li, Mingmin Zheng, Jia Zhang, Qian Yu, Miao Zhang, Huabing Ping, Fan Li, Ming Xiao, Xinhua Identification and functional analysis of GCK gene mutations in 12 Chinese families with hyperglycemia |
title | Identification and functional analysis of GCK gene mutations in 12 Chinese families with hyperglycemia |
title_full | Identification and functional analysis of GCK gene mutations in 12 Chinese families with hyperglycemia |
title_fullStr | Identification and functional analysis of GCK gene mutations in 12 Chinese families with hyperglycemia |
title_full_unstemmed | Identification and functional analysis of GCK gene mutations in 12 Chinese families with hyperglycemia |
title_short | Identification and functional analysis of GCK gene mutations in 12 Chinese families with hyperglycemia |
title_sort | identification and functional analysis of gck gene mutations in 12 chinese families with hyperglycemia |
topic | Articles |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6626954/ https://www.ncbi.nlm.nih.gov/pubmed/30592380 http://dx.doi.org/10.1111/jdi.13001 |
work_keys_str_mv | AT wangzhixin identificationandfunctionalanalysisofgckgenemutationsin12chinesefamilieswithhyperglycemia AT diaochengming identificationandfunctionalanalysisofgckgenemutationsin12chinesefamilieswithhyperglycemia AT liuyijing identificationandfunctionalanalysisofgckgenemutationsin12chinesefamilieswithhyperglycemia AT limingmin identificationandfunctionalanalysisofgckgenemutationsin12chinesefamilieswithhyperglycemia AT zhengjia identificationandfunctionalanalysisofgckgenemutationsin12chinesefamilieswithhyperglycemia AT zhangqian identificationandfunctionalanalysisofgckgenemutationsin12chinesefamilieswithhyperglycemia AT yumiao identificationandfunctionalanalysisofgckgenemutationsin12chinesefamilieswithhyperglycemia AT zhanghuabing identificationandfunctionalanalysisofgckgenemutationsin12chinesefamilieswithhyperglycemia AT pingfan identificationandfunctionalanalysisofgckgenemutationsin12chinesefamilieswithhyperglycemia AT liming identificationandfunctionalanalysisofgckgenemutationsin12chinesefamilieswithhyperglycemia AT xiaoxinhua identificationandfunctionalanalysisofgckgenemutationsin12chinesefamilieswithhyperglycemia |