Cargando…
Effects of recombinant human bone morphogenetic protein-2 compared to other biomaterials in the treatment of intrabony defects in periodontitis patients: A systematic review
BACKGROUND: Bone morphogenetic proteins have a powerful osteoinductive capacity and have been used as a new adjunct to graft materials for bone regeneration. The objectives of this systematic review are to assess the amount of radiographic bone fill, clinical attachment level (CAL) gain, and reducti...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Wolters Kluwer - Medknow
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6628765/ https://www.ncbi.nlm.nih.gov/pubmed/31367126 http://dx.doi.org/10.4103/jisp.jisp_748_18 |
_version_ | 1783435014585712640 |
---|---|
author | Medikeri, Raghavendra Shrishail Meharwade, Vinayak Venkoosa Sinha, Kumar Ankit |
author_facet | Medikeri, Raghavendra Shrishail Meharwade, Vinayak Venkoosa Sinha, Kumar Ankit |
author_sort | Medikeri, Raghavendra Shrishail |
collection | PubMed |
description | BACKGROUND: Bone morphogenetic proteins have a powerful osteoinductive capacity and have been used as a new adjunct to graft materials for bone regeneration. The objectives of this systematic review are to assess the amount of radiographic bone fill, clinical attachment level (CAL) gain, and reduction in pocket depth (PD) in patients with intrabony defects in periodontitis patients following the use of recombinant human bone morphogenetic protein-2 (rhBMP-2). MATERIALS AND METHODS: Electronic bibliographic databases search of Medline, Science Direct, and Google Scholar was made from January 1980 to December 2017. Studies using rhBMP-2 to treat periodontal intrabony defects of the maxillary or mandibular region with follow-up period of at least 6 months were searched. Two reviewers performed the systematic review using the PRISMA Statement for reporting and the Cochrane risk-of-bias tool was used for quality assessment. RESULTS: It was found that rhBMP-2 showed statistically significant results with respect to radiographic defect resolution, CAL, and PD reduction at 9 months compared to open-flap debridement but showed statistically significant results only with respect to radiographic bone fill when compared with platelet-rich fibrin at 6 months. CONCLUSION: The rhBMP-2 may provide a promising alternative to traditional grafting procedures therapy that can enhance periodontal regeneration in patients having intrabony defects. Due to limited human studies, it can be concluded that no definitive evidence exists to ascertain the effectiveness of rhBMP-2 in the treatment of intrabony defects in periodontal diseases. |
format | Online Article Text |
id | pubmed-6628765 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Wolters Kluwer - Medknow |
record_format | MEDLINE/PubMed |
spelling | pubmed-66287652019-07-31 Effects of recombinant human bone morphogenetic protein-2 compared to other biomaterials in the treatment of intrabony defects in periodontitis patients: A systematic review Medikeri, Raghavendra Shrishail Meharwade, Vinayak Venkoosa Sinha, Kumar Ankit J Indian Soc Periodontol Review Article BACKGROUND: Bone morphogenetic proteins have a powerful osteoinductive capacity and have been used as a new adjunct to graft materials for bone regeneration. The objectives of this systematic review are to assess the amount of radiographic bone fill, clinical attachment level (CAL) gain, and reduction in pocket depth (PD) in patients with intrabony defects in periodontitis patients following the use of recombinant human bone morphogenetic protein-2 (rhBMP-2). MATERIALS AND METHODS: Electronic bibliographic databases search of Medline, Science Direct, and Google Scholar was made from January 1980 to December 2017. Studies using rhBMP-2 to treat periodontal intrabony defects of the maxillary or mandibular region with follow-up period of at least 6 months were searched. Two reviewers performed the systematic review using the PRISMA Statement for reporting and the Cochrane risk-of-bias tool was used for quality assessment. RESULTS: It was found that rhBMP-2 showed statistically significant results with respect to radiographic defect resolution, CAL, and PD reduction at 9 months compared to open-flap debridement but showed statistically significant results only with respect to radiographic bone fill when compared with platelet-rich fibrin at 6 months. CONCLUSION: The rhBMP-2 may provide a promising alternative to traditional grafting procedures therapy that can enhance periodontal regeneration in patients having intrabony defects. Due to limited human studies, it can be concluded that no definitive evidence exists to ascertain the effectiveness of rhBMP-2 in the treatment of intrabony defects in periodontal diseases. Wolters Kluwer - Medknow 2019 /pmc/articles/PMC6628765/ /pubmed/31367126 http://dx.doi.org/10.4103/jisp.jisp_748_18 Text en Copyright: © 2019 Journal of Indian Society of Periodontology http://creativecommons.org/licenses/by-nc-sa/4.0 This is an open access journal, and articles are distributed under the terms of the Creative Commons Attribution-NonCommercial-ShareAlike 4.0 License, which allows others to remix, tweak, and build upon the work non-commercially, as long as appropriate credit is given and the new creations are licensed under the identical terms. |
spellingShingle | Review Article Medikeri, Raghavendra Shrishail Meharwade, Vinayak Venkoosa Sinha, Kumar Ankit Effects of recombinant human bone morphogenetic protein-2 compared to other biomaterials in the treatment of intrabony defects in periodontitis patients: A systematic review |
title | Effects of recombinant human bone morphogenetic protein-2 compared to other biomaterials in the treatment of intrabony defects in periodontitis patients: A systematic review |
title_full | Effects of recombinant human bone morphogenetic protein-2 compared to other biomaterials in the treatment of intrabony defects in periodontitis patients: A systematic review |
title_fullStr | Effects of recombinant human bone morphogenetic protein-2 compared to other biomaterials in the treatment of intrabony defects in periodontitis patients: A systematic review |
title_full_unstemmed | Effects of recombinant human bone morphogenetic protein-2 compared to other biomaterials in the treatment of intrabony defects in periodontitis patients: A systematic review |
title_short | Effects of recombinant human bone morphogenetic protein-2 compared to other biomaterials in the treatment of intrabony defects in periodontitis patients: A systematic review |
title_sort | effects of recombinant human bone morphogenetic protein-2 compared to other biomaterials in the treatment of intrabony defects in periodontitis patients: a systematic review |
topic | Review Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6628765/ https://www.ncbi.nlm.nih.gov/pubmed/31367126 http://dx.doi.org/10.4103/jisp.jisp_748_18 |
work_keys_str_mv | AT medikeriraghavendrashrishail effectsofrecombinanthumanbonemorphogeneticprotein2comparedtootherbiomaterialsinthetreatmentofintrabonydefectsinperiodontitispatientsasystematicreview AT meharwadevinayakvenkoosa effectsofrecombinanthumanbonemorphogeneticprotein2comparedtootherbiomaterialsinthetreatmentofintrabonydefectsinperiodontitispatientsasystematicreview AT sinhakumarankit effectsofrecombinanthumanbonemorphogeneticprotein2comparedtootherbiomaterialsinthetreatmentofintrabonydefectsinperiodontitispatientsasystematicreview |