Cargando…

Clinical features and genetic characteristics of two Chinese pedigrees with fatal family insomnia

Background: Fatal familial insomnia (FFI) is a rare autosomal-dominant inherited prion disease characterized clinically by severe sleep disorder, motor signs, dysautonomia and abnormal behaviour. FFI is caused by a missense mutation at codon 178 of the prion protein gene (PRNP). Our study is aimed t...

Descripción completa

Detalles Bibliográficos
Autores principales: He, Runcheng, Hu, Yacen, Yao, Lingyan, Tian, Yun, Zhou, Yafang, Yi, Fang, Zhou, Lin, Xu, Hongwei, Sun, Qiying
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Taylor & Francis 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6629183/
https://www.ncbi.nlm.nih.gov/pubmed/31122137
http://dx.doi.org/10.1080/19336896.2019.1617027
_version_ 1783435063341350912
author He, Runcheng
Hu, Yacen
Yao, Lingyan
Tian, Yun
Zhou, Yafang
Yi, Fang
Zhou, Lin
Xu, Hongwei
Sun, Qiying
author_facet He, Runcheng
Hu, Yacen
Yao, Lingyan
Tian, Yun
Zhou, Yafang
Yi, Fang
Zhou, Lin
Xu, Hongwei
Sun, Qiying
author_sort He, Runcheng
collection PubMed
description Background: Fatal familial insomnia (FFI) is a rare autosomal-dominant inherited prion disease characterized clinically by severe sleep disorder, motor signs, dysautonomia and abnormal behaviour. FFI is caused by a missense mutation at codon 178 of the prion protein gene (PRNP). Our study is aimed to explore typical clinical and genetic features of two Chinese pedigrees with FFI and review the related literatures. Methods: Two FFI cases with family histories were recruited in our study. The main clinical features, genetic features and possible pathophysiologic mechanisms of these two FFI cases were analysed. Results: The foremost symptoms seemed to be sleep disturbances and psychosis. Progressive sympathetic symptoms, movement disturbances and memory loss were frequently observed as well. Electroencephalography (EEG) showed a minor slowing without periodic triphasic waves. Polysomnography (PSG) showed reduction in total sleep time and disturbance of sleep-related respiratory. Brain magnetic resonance imaging (MRI) did not reveal obvious abnormality. Genetic analysis disclosed the prion protein gene mutation at codon 178 (D178N), with methionine (Met) homozygosity at the polymorphic position 129 (Met129Met). Conclusions: The major clinical features of Chinese FFI are sleep dysfunction, psychiatric symptoms and sympathetic symptoms. Our patients have similar clinical characteristics as that of the typical FFI cases.
format Online
Article
Text
id pubmed-6629183
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Taylor & Francis
record_format MEDLINE/PubMed
spelling pubmed-66291832019-07-18 Clinical features and genetic characteristics of two Chinese pedigrees with fatal family insomnia He, Runcheng Hu, Yacen Yao, Lingyan Tian, Yun Zhou, Yafang Yi, Fang Zhou, Lin Xu, Hongwei Sun, Qiying Prion Research Paper Background: Fatal familial insomnia (FFI) is a rare autosomal-dominant inherited prion disease characterized clinically by severe sleep disorder, motor signs, dysautonomia and abnormal behaviour. FFI is caused by a missense mutation at codon 178 of the prion protein gene (PRNP). Our study is aimed to explore typical clinical and genetic features of two Chinese pedigrees with FFI and review the related literatures. Methods: Two FFI cases with family histories were recruited in our study. The main clinical features, genetic features and possible pathophysiologic mechanisms of these two FFI cases were analysed. Results: The foremost symptoms seemed to be sleep disturbances and psychosis. Progressive sympathetic symptoms, movement disturbances and memory loss were frequently observed as well. Electroencephalography (EEG) showed a minor slowing without periodic triphasic waves. Polysomnography (PSG) showed reduction in total sleep time and disturbance of sleep-related respiratory. Brain magnetic resonance imaging (MRI) did not reveal obvious abnormality. Genetic analysis disclosed the prion protein gene mutation at codon 178 (D178N), with methionine (Met) homozygosity at the polymorphic position 129 (Met129Met). Conclusions: The major clinical features of Chinese FFI are sleep dysfunction, psychiatric symptoms and sympathetic symptoms. Our patients have similar clinical characteristics as that of the typical FFI cases. Taylor & Francis 2019-05-23 /pmc/articles/PMC6629183/ /pubmed/31122137 http://dx.doi.org/10.1080/19336896.2019.1617027 Text en © 2019 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. http://creativecommons.org/licenses/by/4.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Paper
He, Runcheng
Hu, Yacen
Yao, Lingyan
Tian, Yun
Zhou, Yafang
Yi, Fang
Zhou, Lin
Xu, Hongwei
Sun, Qiying
Clinical features and genetic characteristics of two Chinese pedigrees with fatal family insomnia
title Clinical features and genetic characteristics of two Chinese pedigrees with fatal family insomnia
title_full Clinical features and genetic characteristics of two Chinese pedigrees with fatal family insomnia
title_fullStr Clinical features and genetic characteristics of two Chinese pedigrees with fatal family insomnia
title_full_unstemmed Clinical features and genetic characteristics of two Chinese pedigrees with fatal family insomnia
title_short Clinical features and genetic characteristics of two Chinese pedigrees with fatal family insomnia
title_sort clinical features and genetic characteristics of two chinese pedigrees with fatal family insomnia
topic Research Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6629183/
https://www.ncbi.nlm.nih.gov/pubmed/31122137
http://dx.doi.org/10.1080/19336896.2019.1617027
work_keys_str_mv AT heruncheng clinicalfeaturesandgeneticcharacteristicsoftwochinesepedigreeswithfatalfamilyinsomnia
AT huyacen clinicalfeaturesandgeneticcharacteristicsoftwochinesepedigreeswithfatalfamilyinsomnia
AT yaolingyan clinicalfeaturesandgeneticcharacteristicsoftwochinesepedigreeswithfatalfamilyinsomnia
AT tianyun clinicalfeaturesandgeneticcharacteristicsoftwochinesepedigreeswithfatalfamilyinsomnia
AT zhouyafang clinicalfeaturesandgeneticcharacteristicsoftwochinesepedigreeswithfatalfamilyinsomnia
AT yifang clinicalfeaturesandgeneticcharacteristicsoftwochinesepedigreeswithfatalfamilyinsomnia
AT zhoulin clinicalfeaturesandgeneticcharacteristicsoftwochinesepedigreeswithfatalfamilyinsomnia
AT xuhongwei clinicalfeaturesandgeneticcharacteristicsoftwochinesepedigreeswithfatalfamilyinsomnia
AT sunqiying clinicalfeaturesandgeneticcharacteristicsoftwochinesepedigreeswithfatalfamilyinsomnia