Cargando…
Clinical features and genetic characteristics of two Chinese pedigrees with fatal family insomnia
Background: Fatal familial insomnia (FFI) is a rare autosomal-dominant inherited prion disease characterized clinically by severe sleep disorder, motor signs, dysautonomia and abnormal behaviour. FFI is caused by a missense mutation at codon 178 of the prion protein gene (PRNP). Our study is aimed t...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Taylor & Francis
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6629183/ https://www.ncbi.nlm.nih.gov/pubmed/31122137 http://dx.doi.org/10.1080/19336896.2019.1617027 |
_version_ | 1783435063341350912 |
---|---|
author | He, Runcheng Hu, Yacen Yao, Lingyan Tian, Yun Zhou, Yafang Yi, Fang Zhou, Lin Xu, Hongwei Sun, Qiying |
author_facet | He, Runcheng Hu, Yacen Yao, Lingyan Tian, Yun Zhou, Yafang Yi, Fang Zhou, Lin Xu, Hongwei Sun, Qiying |
author_sort | He, Runcheng |
collection | PubMed |
description | Background: Fatal familial insomnia (FFI) is a rare autosomal-dominant inherited prion disease characterized clinically by severe sleep disorder, motor signs, dysautonomia and abnormal behaviour. FFI is caused by a missense mutation at codon 178 of the prion protein gene (PRNP). Our study is aimed to explore typical clinical and genetic features of two Chinese pedigrees with FFI and review the related literatures. Methods: Two FFI cases with family histories were recruited in our study. The main clinical features, genetic features and possible pathophysiologic mechanisms of these two FFI cases were analysed. Results: The foremost symptoms seemed to be sleep disturbances and psychosis. Progressive sympathetic symptoms, movement disturbances and memory loss were frequently observed as well. Electroencephalography (EEG) showed a minor slowing without periodic triphasic waves. Polysomnography (PSG) showed reduction in total sleep time and disturbance of sleep-related respiratory. Brain magnetic resonance imaging (MRI) did not reveal obvious abnormality. Genetic analysis disclosed the prion protein gene mutation at codon 178 (D178N), with methionine (Met) homozygosity at the polymorphic position 129 (Met129Met). Conclusions: The major clinical features of Chinese FFI are sleep dysfunction, psychiatric symptoms and sympathetic symptoms. Our patients have similar clinical characteristics as that of the typical FFI cases. |
format | Online Article Text |
id | pubmed-6629183 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Taylor & Francis |
record_format | MEDLINE/PubMed |
spelling | pubmed-66291832019-07-18 Clinical features and genetic characteristics of two Chinese pedigrees with fatal family insomnia He, Runcheng Hu, Yacen Yao, Lingyan Tian, Yun Zhou, Yafang Yi, Fang Zhou, Lin Xu, Hongwei Sun, Qiying Prion Research Paper Background: Fatal familial insomnia (FFI) is a rare autosomal-dominant inherited prion disease characterized clinically by severe sleep disorder, motor signs, dysautonomia and abnormal behaviour. FFI is caused by a missense mutation at codon 178 of the prion protein gene (PRNP). Our study is aimed to explore typical clinical and genetic features of two Chinese pedigrees with FFI and review the related literatures. Methods: Two FFI cases with family histories were recruited in our study. The main clinical features, genetic features and possible pathophysiologic mechanisms of these two FFI cases were analysed. Results: The foremost symptoms seemed to be sleep disturbances and psychosis. Progressive sympathetic symptoms, movement disturbances and memory loss were frequently observed as well. Electroencephalography (EEG) showed a minor slowing without periodic triphasic waves. Polysomnography (PSG) showed reduction in total sleep time and disturbance of sleep-related respiratory. Brain magnetic resonance imaging (MRI) did not reveal obvious abnormality. Genetic analysis disclosed the prion protein gene mutation at codon 178 (D178N), with methionine (Met) homozygosity at the polymorphic position 129 (Met129Met). Conclusions: The major clinical features of Chinese FFI are sleep dysfunction, psychiatric symptoms and sympathetic symptoms. Our patients have similar clinical characteristics as that of the typical FFI cases. Taylor & Francis 2019-05-23 /pmc/articles/PMC6629183/ /pubmed/31122137 http://dx.doi.org/10.1080/19336896.2019.1617027 Text en © 2019 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. http://creativecommons.org/licenses/by/4.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Paper He, Runcheng Hu, Yacen Yao, Lingyan Tian, Yun Zhou, Yafang Yi, Fang Zhou, Lin Xu, Hongwei Sun, Qiying Clinical features and genetic characteristics of two Chinese pedigrees with fatal family insomnia |
title | Clinical features and genetic characteristics of two Chinese pedigrees with fatal family insomnia |
title_full | Clinical features and genetic characteristics of two Chinese pedigrees with fatal family insomnia |
title_fullStr | Clinical features and genetic characteristics of two Chinese pedigrees with fatal family insomnia |
title_full_unstemmed | Clinical features and genetic characteristics of two Chinese pedigrees with fatal family insomnia |
title_short | Clinical features and genetic characteristics of two Chinese pedigrees with fatal family insomnia |
title_sort | clinical features and genetic characteristics of two chinese pedigrees with fatal family insomnia |
topic | Research Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6629183/ https://www.ncbi.nlm.nih.gov/pubmed/31122137 http://dx.doi.org/10.1080/19336896.2019.1617027 |
work_keys_str_mv | AT heruncheng clinicalfeaturesandgeneticcharacteristicsoftwochinesepedigreeswithfatalfamilyinsomnia AT huyacen clinicalfeaturesandgeneticcharacteristicsoftwochinesepedigreeswithfatalfamilyinsomnia AT yaolingyan clinicalfeaturesandgeneticcharacteristicsoftwochinesepedigreeswithfatalfamilyinsomnia AT tianyun clinicalfeaturesandgeneticcharacteristicsoftwochinesepedigreeswithfatalfamilyinsomnia AT zhouyafang clinicalfeaturesandgeneticcharacteristicsoftwochinesepedigreeswithfatalfamilyinsomnia AT yifang clinicalfeaturesandgeneticcharacteristicsoftwochinesepedigreeswithfatalfamilyinsomnia AT zhoulin clinicalfeaturesandgeneticcharacteristicsoftwochinesepedigreeswithfatalfamilyinsomnia AT xuhongwei clinicalfeaturesandgeneticcharacteristicsoftwochinesepedigreeswithfatalfamilyinsomnia AT sunqiying clinicalfeaturesandgeneticcharacteristicsoftwochinesepedigreeswithfatalfamilyinsomnia |