Cargando…
Nephropathy in Hypertensive Animals Is Linked to M2 Macrophages and Increased Expression of the YM1/Chi3l3 Protein
Macrophages contribute to a continuous increase in blood pressure and kidney damage in hypertension, but their polarization status and the underlying mechanisms have not been clarified. This study revealed an important role for M2 macrophages and the YM1/Chi3l3 protein in hypertensive nephropathy in...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Hindawi
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6652056/ https://www.ncbi.nlm.nih.gov/pubmed/31360120 http://dx.doi.org/10.1155/2019/9086758 |
_version_ | 1783438488375394304 |
---|---|
author | Cavalcante, Paula Andréa Malveira Alenina, Natalia Budu, Alexandre Freitas-Lima, Leandro Ceotto Alves-Silva, Thaís Agudelo, Juan Sebastian Henao Qadri, Fatimunnisa Camara, Niels Olsen Saraiva Bader, Michael Araújo, Ronaldo Carvalho |
author_facet | Cavalcante, Paula Andréa Malveira Alenina, Natalia Budu, Alexandre Freitas-Lima, Leandro Ceotto Alves-Silva, Thaís Agudelo, Juan Sebastian Henao Qadri, Fatimunnisa Camara, Niels Olsen Saraiva Bader, Michael Araújo, Ronaldo Carvalho |
author_sort | Cavalcante, Paula Andréa Malveira |
collection | PubMed |
description | Macrophages contribute to a continuous increase in blood pressure and kidney damage in hypertension, but their polarization status and the underlying mechanisms have not been clarified. This study revealed an important role for M2 macrophages and the YM1/Chi3l3 protein in hypertensive nephropathy in a mouse model of hypertension. Bone marrow cells were isolated from the femurs and tibia of male FVB/N (control) and transgenic hypertensive animals that overexpressed the rat form of angiotensinogen (TGM(rAOGEN)123, TGM123-FVB/N). The cells were treated with murine M-CSF and subsequently with LPS+IFN-γ to promote their polarization into M1 macrophages and IL-4+IL-13 to trigger the M2 phenotype. We examined the kidneys of TGM123-FVB/N animals to assess macrophage polarization and end-organ damage. mRNA expression was evaluated using real-time PCR, and protein levels were assessed through ELISA, CBA, Western blot, and immunofluorescence. Histology confirmed high levels of renal collagen. Cells stimulated with LPS+IFN-γ in vitro showed no significant difference in the expression of CD86, an M1 marker, compared to cells from the controls or the hypertensive mice. When stimulated with IL-4+IL-13, however, macrophages of the hypertensive group showed a significant increase in CD206 expression, an M2 marker. The M2/M1 ratio reached 288%. Our results indicate that when stimulated in vitro, macrophages from hypertensive mice are predisposed toward polarization to an M2 phenotype. These data support results from the kidneys where we found an increased infiltration of macrophages predominantly polarized to M2 associated with high levels of YM1/Chi3l3 (91,89%), suggesting that YM1/Chi3l3 may be a biomarker of hypertensive nephropathy. |
format | Online Article Text |
id | pubmed-6652056 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Hindawi |
record_format | MEDLINE/PubMed |
spelling | pubmed-66520562019-07-29 Nephropathy in Hypertensive Animals Is Linked to M2 Macrophages and Increased Expression of the YM1/Chi3l3 Protein Cavalcante, Paula Andréa Malveira Alenina, Natalia Budu, Alexandre Freitas-Lima, Leandro Ceotto Alves-Silva, Thaís Agudelo, Juan Sebastian Henao Qadri, Fatimunnisa Camara, Niels Olsen Saraiva Bader, Michael Araújo, Ronaldo Carvalho Mediators Inflamm Research Article Macrophages contribute to a continuous increase in blood pressure and kidney damage in hypertension, but their polarization status and the underlying mechanisms have not been clarified. This study revealed an important role for M2 macrophages and the YM1/Chi3l3 protein in hypertensive nephropathy in a mouse model of hypertension. Bone marrow cells were isolated from the femurs and tibia of male FVB/N (control) and transgenic hypertensive animals that overexpressed the rat form of angiotensinogen (TGM(rAOGEN)123, TGM123-FVB/N). The cells were treated with murine M-CSF and subsequently with LPS+IFN-γ to promote their polarization into M1 macrophages and IL-4+IL-13 to trigger the M2 phenotype. We examined the kidneys of TGM123-FVB/N animals to assess macrophage polarization and end-organ damage. mRNA expression was evaluated using real-time PCR, and protein levels were assessed through ELISA, CBA, Western blot, and immunofluorescence. Histology confirmed high levels of renal collagen. Cells stimulated with LPS+IFN-γ in vitro showed no significant difference in the expression of CD86, an M1 marker, compared to cells from the controls or the hypertensive mice. When stimulated with IL-4+IL-13, however, macrophages of the hypertensive group showed a significant increase in CD206 expression, an M2 marker. The M2/M1 ratio reached 288%. Our results indicate that when stimulated in vitro, macrophages from hypertensive mice are predisposed toward polarization to an M2 phenotype. These data support results from the kidneys where we found an increased infiltration of macrophages predominantly polarized to M2 associated with high levels of YM1/Chi3l3 (91,89%), suggesting that YM1/Chi3l3 may be a biomarker of hypertensive nephropathy. Hindawi 2019-07-10 /pmc/articles/PMC6652056/ /pubmed/31360120 http://dx.doi.org/10.1155/2019/9086758 Text en Copyright © 2019 Paula Andréa Malveira Cavalcante et al. http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Cavalcante, Paula Andréa Malveira Alenina, Natalia Budu, Alexandre Freitas-Lima, Leandro Ceotto Alves-Silva, Thaís Agudelo, Juan Sebastian Henao Qadri, Fatimunnisa Camara, Niels Olsen Saraiva Bader, Michael Araújo, Ronaldo Carvalho Nephropathy in Hypertensive Animals Is Linked to M2 Macrophages and Increased Expression of the YM1/Chi3l3 Protein |
title | Nephropathy in Hypertensive Animals Is Linked to M2 Macrophages and Increased Expression of the YM1/Chi3l3 Protein |
title_full | Nephropathy in Hypertensive Animals Is Linked to M2 Macrophages and Increased Expression of the YM1/Chi3l3 Protein |
title_fullStr | Nephropathy in Hypertensive Animals Is Linked to M2 Macrophages and Increased Expression of the YM1/Chi3l3 Protein |
title_full_unstemmed | Nephropathy in Hypertensive Animals Is Linked to M2 Macrophages and Increased Expression of the YM1/Chi3l3 Protein |
title_short | Nephropathy in Hypertensive Animals Is Linked to M2 Macrophages and Increased Expression of the YM1/Chi3l3 Protein |
title_sort | nephropathy in hypertensive animals is linked to m2 macrophages and increased expression of the ym1/chi3l3 protein |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6652056/ https://www.ncbi.nlm.nih.gov/pubmed/31360120 http://dx.doi.org/10.1155/2019/9086758 |
work_keys_str_mv | AT cavalcantepaulaandreamalveira nephropathyinhypertensiveanimalsislinkedtom2macrophagesandincreasedexpressionoftheym1chi3l3protein AT aleninanatalia nephropathyinhypertensiveanimalsislinkedtom2macrophagesandincreasedexpressionoftheym1chi3l3protein AT budualexandre nephropathyinhypertensiveanimalsislinkedtom2macrophagesandincreasedexpressionoftheym1chi3l3protein AT freitaslimaleandroceotto nephropathyinhypertensiveanimalsislinkedtom2macrophagesandincreasedexpressionoftheym1chi3l3protein AT alvessilvathais nephropathyinhypertensiveanimalsislinkedtom2macrophagesandincreasedexpressionoftheym1chi3l3protein AT agudelojuansebastianhenao nephropathyinhypertensiveanimalsislinkedtom2macrophagesandincreasedexpressionoftheym1chi3l3protein AT qadrifatimunnisa nephropathyinhypertensiveanimalsislinkedtom2macrophagesandincreasedexpressionoftheym1chi3l3protein AT camaranielsolsensaraiva nephropathyinhypertensiveanimalsislinkedtom2macrophagesandincreasedexpressionoftheym1chi3l3protein AT badermichael nephropathyinhypertensiveanimalsislinkedtom2macrophagesandincreasedexpressionoftheym1chi3l3protein AT araujoronaldocarvalho nephropathyinhypertensiveanimalsislinkedtom2macrophagesandincreasedexpressionoftheym1chi3l3protein |