Cargando…

Validity of screening instruments for the detection of dementia and mild cognitive impairment in hospital inpatients: A systematic review of diagnostic accuracy studies

INTRODUCTION: As the population ages, Alzheimer's disease and other subtypes of dementia are becoming increasingly prevalent. However, in recent years, diagnosis has often been delayed or not made at all. Thus, improving the rate of diagnosis has become an integral part of national dementia str...

Descripción completa

Detalles Bibliográficos
Autores principales: Hwang, Aljoscha Benjamin, Boes, Stefan, Nyffeler, Thomas, Schuepfer, Guido
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6657852/
https://www.ncbi.nlm.nih.gov/pubmed/31344048
http://dx.doi.org/10.1371/journal.pone.0219569
_version_ 1783438857471000576
author Hwang, Aljoscha Benjamin
Boes, Stefan
Nyffeler, Thomas
Schuepfer, Guido
author_facet Hwang, Aljoscha Benjamin
Boes, Stefan
Nyffeler, Thomas
Schuepfer, Guido
author_sort Hwang, Aljoscha Benjamin
collection PubMed
description INTRODUCTION: As the population ages, Alzheimer's disease and other subtypes of dementia are becoming increasingly prevalent. However, in recent years, diagnosis has often been delayed or not made at all. Thus, improving the rate of diagnosis has become an integral part of national dementia strategies. Although screening for dementia remains controversial, the case is strong for screening for dementia and other forms of cognitive impairment in hospital inpatients. For this reason, the objective of this systematic review was to provide clinicians, who wish to implement screening, an up-to-date choice of cognitive tests with the most extensive evidence base for the use in elective hospital inpatients. METHODS: For this systematic review, PubMed, PsycINFO and Cochrane Library were searched by using a multi-concept search strategy. The databases were accessed on April 10, 2019. All cross-sectional studies that utilized brief, multi-domain cognitive tests as index test and a reference standard diagnosis of dementia or mild cognitive impairment as comparator were included. Only studies conducted in the hospital setting, sampling from unselected, elective inpatients older than 64 were considered. RESULTS: Six studies met the inclusion criteria, with a total of 2112 participants. Diagnostic accuracy data for the Six-Item Cognitive Impairment Test, Cognitive Performance Scale, Clock-Drawing Test, Mini-Mental Status Examination, and Time & Change test were extracted and descriptively analyzed. Clinical and methodological heterogeneity between the studies precluded performing a meta-analysis. DISCUSSION: This review found only a small number of instruments and was not able to recommend a single best instrument for use in a hospital setting. Although it was not possible to estimate the pooled operating characteristics, the included description of instrument characteristics, the descriptive analysis of performance measures, and the critical evaluation of the reporting studies may contribute to clinician's choice of the screening instrument that fits best their purpose.
format Online
Article
Text
id pubmed-6657852
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-66578522019-08-07 Validity of screening instruments for the detection of dementia and mild cognitive impairment in hospital inpatients: A systematic review of diagnostic accuracy studies Hwang, Aljoscha Benjamin Boes, Stefan Nyffeler, Thomas Schuepfer, Guido PLoS One Research Article INTRODUCTION: As the population ages, Alzheimer's disease and other subtypes of dementia are becoming increasingly prevalent. However, in recent years, diagnosis has often been delayed or not made at all. Thus, improving the rate of diagnosis has become an integral part of national dementia strategies. Although screening for dementia remains controversial, the case is strong for screening for dementia and other forms of cognitive impairment in hospital inpatients. For this reason, the objective of this systematic review was to provide clinicians, who wish to implement screening, an up-to-date choice of cognitive tests with the most extensive evidence base for the use in elective hospital inpatients. METHODS: For this systematic review, PubMed, PsycINFO and Cochrane Library were searched by using a multi-concept search strategy. The databases were accessed on April 10, 2019. All cross-sectional studies that utilized brief, multi-domain cognitive tests as index test and a reference standard diagnosis of dementia or mild cognitive impairment as comparator were included. Only studies conducted in the hospital setting, sampling from unselected, elective inpatients older than 64 were considered. RESULTS: Six studies met the inclusion criteria, with a total of 2112 participants. Diagnostic accuracy data for the Six-Item Cognitive Impairment Test, Cognitive Performance Scale, Clock-Drawing Test, Mini-Mental Status Examination, and Time & Change test were extracted and descriptively analyzed. Clinical and methodological heterogeneity between the studies precluded performing a meta-analysis. DISCUSSION: This review found only a small number of instruments and was not able to recommend a single best instrument for use in a hospital setting. Although it was not possible to estimate the pooled operating characteristics, the included description of instrument characteristics, the descriptive analysis of performance measures, and the critical evaluation of the reporting studies may contribute to clinician's choice of the screening instrument that fits best their purpose. Public Library of Science 2019-07-25 /pmc/articles/PMC6657852/ /pubmed/31344048 http://dx.doi.org/10.1371/journal.pone.0219569 Text en © 2019 Hwang et al http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Research Article
Hwang, Aljoscha Benjamin
Boes, Stefan
Nyffeler, Thomas
Schuepfer, Guido
Validity of screening instruments for the detection of dementia and mild cognitive impairment in hospital inpatients: A systematic review of diagnostic accuracy studies
title Validity of screening instruments for the detection of dementia and mild cognitive impairment in hospital inpatients: A systematic review of diagnostic accuracy studies
title_full Validity of screening instruments for the detection of dementia and mild cognitive impairment in hospital inpatients: A systematic review of diagnostic accuracy studies
title_fullStr Validity of screening instruments for the detection of dementia and mild cognitive impairment in hospital inpatients: A systematic review of diagnostic accuracy studies
title_full_unstemmed Validity of screening instruments for the detection of dementia and mild cognitive impairment in hospital inpatients: A systematic review of diagnostic accuracy studies
title_short Validity of screening instruments for the detection of dementia and mild cognitive impairment in hospital inpatients: A systematic review of diagnostic accuracy studies
title_sort validity of screening instruments for the detection of dementia and mild cognitive impairment in hospital inpatients: a systematic review of diagnostic accuracy studies
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6657852/
https://www.ncbi.nlm.nih.gov/pubmed/31344048
http://dx.doi.org/10.1371/journal.pone.0219569
work_keys_str_mv AT hwangaljoschabenjamin validityofscreeninginstrumentsforthedetectionofdementiaandmildcognitiveimpairmentinhospitalinpatientsasystematicreviewofdiagnosticaccuracystudies
AT boesstefan validityofscreeninginstrumentsforthedetectionofdementiaandmildcognitiveimpairmentinhospitalinpatientsasystematicreviewofdiagnosticaccuracystudies
AT nyffelerthomas validityofscreeninginstrumentsforthedetectionofdementiaandmildcognitiveimpairmentinhospitalinpatientsasystematicreviewofdiagnosticaccuracystudies
AT schuepferguido validityofscreeninginstrumentsforthedetectionofdementiaandmildcognitiveimpairmentinhospitalinpatientsasystematicreviewofdiagnosticaccuracystudies