iRoot BP Plus promotes osteo/odontogenic differentiation of bone marrow mesenchymal stem cells via MAPK pathways and autophagy

BACKGROUND: iRoot BP Plus is a novel bioceramic endodontic material. Recently, it has been considered as an alternative to MTA which is the most popular scaffold cover during regenerative endodontic therapy. This study aimed to evaluate the effects of iRoot BP Plus on the osteo/odontogenic capacity...

Descripción completa

Detalles Bibliográficos
Autores principales: Lu, Jiamin, Li, Zehan, Wu, Xiao, Chen, Yan, Yan, Ming, Ge, Xingyun, Yu, Jinhua
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2019
Materias:
Research
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6664598/
https://www.ncbi.nlm.nih.gov/pubmed/31358050
http://dx.doi.org/10.1186/s13287-019-1345-3
_version_ 1783439918539735040
author Lu, Jiamin
Li, Zehan
Wu, Xiao
Chen, Yan
Yan, Ming
Ge, Xingyun
Yu, Jinhua
author_facet Lu, Jiamin
Li, Zehan
Wu, Xiao
Chen, Yan
Yan, Ming
Ge, Xingyun
Yu, Jinhua
author_sort Lu, Jiamin
collection PubMed
description BACKGROUND: iRoot BP Plus is a novel bioceramic endodontic material. Recently, it has been considered as an alternative to MTA which is the most popular scaffold cover during regenerative endodontic therapy. This study aimed to evaluate the effects of iRoot BP Plus on the osteo/odontogenic capacity of bone marrow mesenchymal stem cells (BMMSCs), including the underlying mechanisms. METHODS: BMMSCs were collected by a whole marrow method and treated with iRoot BP Plus-conditioned medium (BP-CM). The proliferation ability was evaluated by cell counting kit 8 and flow cytometry. Complete medium was used as a blank control, and 2 mg/ml MTA-conditioned medium was served as a positive control. Alkaline phosphatase (ALP) activity assay, ALP staining, western blot, real-time RT-PCR, Alizarin Red S staining, and immunofluorescence staining were performed to explore the osteo/odontogenic potential and the involvement of MAPK pathways. Besides, autophagy was investigated by western blot, immunofluorescence staining, and transmission electron microscopy. RESULTS:
format Online
Article
Text
id pubmed-6664598
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-66645982019-08-05 iRoot BP Plus promotes osteo/odontogenic differentiation of bone marrow mesenchymal stem cells via MAPK pathways and autophagy Lu, Jiamin Li, Zehan Wu, Xiao Chen, Yan Yan, Ming Ge, Xingyun Yu, Jinhua Stem Cell Res Ther Research BACKGROUND: iRoot BP Plus is a novel bioceramic endodontic material. Recently, it has been considered as an alternative to MTA which is the most popular scaffold cover during regenerative endodontic therapy. This study aimed to evaluate the effects of iRoot BP Plus on the osteo/odontogenic capacity of bone marrow mesenchymal stem cells (BMMSCs), including the underlying mechanisms. METHODS: BMMSCs were collected by a whole marrow method and treated with iRoot BP Plus-conditioned medium (BP-CM). The proliferation ability was evaluated by cell counting kit 8 and flow cytometry. Complete medium was used as a blank control, and 2 mg/ml MTA-conditioned medium was served as a positive control. Alkaline phosphatase (ALP) activity assay, ALP staining, western blot, real-time RT-PCR, Alizarin Red S staining, and immunofluorescence staining were performed to explore the osteo/odontogenic potential and the involvement of MAPK pathways. Besides, autophagy was investigated by western blot, immunofluorescence staining, and transmission electron microscopy. RESULTS: BioMed Central 2019-07-29 /pmc/articles/PMC6664598/ /pubmed/31358050 http://dx.doi.org/10.1186/s13287-019-1345-3 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Lu, Jiamin
Li, Zehan
Wu, Xiao
Chen, Yan
Yan, Ming
Ge, Xingyun
Yu, Jinhua
iRoot BP Plus promotes osteo/odontogenic differentiation of bone marrow mesenchymal stem cells via MAPK pathways and autophagy
title iRoot BP Plus promotes osteo/odontogenic differentiation of bone marrow mesenchymal stem cells via MAPK pathways and autophagy
title_full iRoot BP Plus promotes osteo/odontogenic differentiation of bone marrow mesenchymal stem cells via MAPK pathways and autophagy
title_fullStr iRoot BP Plus promotes osteo/odontogenic differentiation of bone marrow mesenchymal stem cells via MAPK pathways and autophagy
title_full_unstemmed iRoot BP Plus promotes osteo/odontogenic differentiation of bone marrow mesenchymal stem cells via MAPK pathways and autophagy
title_short iRoot BP Plus promotes osteo/odontogenic differentiation of bone marrow mesenchymal stem cells via MAPK pathways and autophagy
title_sort iroot bp plus promotes osteo/odontogenic differentiation of bone marrow mesenchymal stem cells via mapk pathways and autophagy
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6664598/
https://www.ncbi.nlm.nih.gov/pubmed/31358050
http://dx.doi.org/10.1186/s13287-019-1345-3
work_keys_str_mv AT lujiamin irootbppluspromotesosteoodontogenicdifferentiationofbonemarrowmesenchymalstemcellsviamapkpathwaysandautophagy
AT lizehan irootbppluspromotesosteoodontogenicdifferentiationofbonemarrowmesenchymalstemcellsviamapkpathwaysandautophagy
AT wuxiao irootbppluspromotesosteoodontogenicdifferentiationofbonemarrowmesenchymalstemcellsviamapkpathwaysandautophagy
AT chenyan irootbppluspromotesosteoodontogenicdifferentiationofbonemarrowmesenchymalstemcellsviamapkpathwaysandautophagy
AT yanming irootbppluspromotesosteoodontogenicdifferentiationofbonemarrowmesenchymalstemcellsviamapkpathwaysandautophagy
AT gexingyun irootbppluspromotesosteoodontogenicdifferentiationofbonemarrowmesenchymalstemcellsviamapkpathwaysandautophagy
AT yujinhua irootbppluspromotesosteoodontogenicdifferentiationofbonemarrowmesenchymalstemcellsviamapkpathwaysandautophagy

Ejemplares similares