Cargando…

Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook

BACKGROUND: Assessing the risk of bias (RoB) in included studies is one of the key methodological aspects of systematic reviews. Cochrane systematic reviews appraise RoB of randomised controlled trials (RCTs) with the Cochrane RoB tool. Detailed instructions for using the Cochrane RoB tool are provi...

Descripción completa

Detalles Bibliográficos
Autores principales: Barcot, Ognjen, Boric, Matija, Poklepovic Pericic, Tina, Cavar, Marija, Dosenovic, Svjetlana, Vuka, Ivana, Puljak, Livia
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6683577/
https://www.ncbi.nlm.nih.gov/pubmed/31382898
http://dx.doi.org/10.1186/s12874-019-0804-y
_version_ 1783442124407046144
author Barcot, Ognjen
Boric, Matija
Poklepovic Pericic, Tina
Cavar, Marija
Dosenovic, Svjetlana
Vuka, Ivana
Puljak, Livia
author_facet Barcot, Ognjen
Boric, Matija
Poklepovic Pericic, Tina
Cavar, Marija
Dosenovic, Svjetlana
Vuka, Ivana
Puljak, Livia
author_sort Barcot, Ognjen
collection PubMed
description BACKGROUND: Assessing the risk of bias (RoB) in included studies is one of the key methodological aspects of systematic reviews. Cochrane systematic reviews appraise RoB of randomised controlled trials (RCTs) with the Cochrane RoB tool. Detailed instructions for using the Cochrane RoB tool are provided in the Cochrane Handbook for Systematic Reviews of Interventions (The Cochrane Handbook). The purpose of this study was to analyse whether Cochrane authors use adequate judgments about the RoB for random sequence generation of RCTs included in Cochrane reviews. METHODS: We extracted authors’ judgments (high, low or unclear RoB) and supports for judgments (comments accompanying judgments which explain the rationale for a judgment) for random sequence generation of included RCTs from RoB tables of Cochrane reviews using automated data scraping. We categorised all supporting comments, analysed the number and type of various supporting comments and assessed adequacy of RoB judgment for randomisation in line with recommendations from the Cochrane Handbook. RESULTS: We analysed 10,103 RCTs that were included in 704 Cochrane reviews. For 5,706 RCTs, randomisation was not described, but for the remaining RCTs, it was indicated that randomisation was performed using computer/software/internet (N = 2,850), random number table (N = 883), mechanical method (N = 359) or it was incomplete/inappropriate (N = 305). Overall, 1,220/10,103 trials (12%) did not have a RoB judgment in line with Cochrane Handbook guidance about randomisation. The highest proportion of misjudgements was found for trials with high RoB (28%), followed by those with low (20%) or unclear (3%). Therefore, one in eight judgments for the analysed domain in Cochrane reviews was not in line with Cochrane Handbook, and one in four if the judgment was "high risk". CONCLUSION: Authors of Cochrane reviews often make judgments about the RoB related to random sequence generation that are not in line with instructions given in the Cochrane Handbook, which compromises the reliability of the systematic reviews. Our results can help authors of both Cochrane and non-Cochrane reviews which use Cochrane RoB tool to avoid making common mistakes when assessing RoB in included trials. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12874-019-0804-y) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-6683577
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-66835772019-08-12 Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook Barcot, Ognjen Boric, Matija Poklepovic Pericic, Tina Cavar, Marija Dosenovic, Svjetlana Vuka, Ivana Puljak, Livia BMC Med Res Methodol Research Article BACKGROUND: Assessing the risk of bias (RoB) in included studies is one of the key methodological aspects of systematic reviews. Cochrane systematic reviews appraise RoB of randomised controlled trials (RCTs) with the Cochrane RoB tool. Detailed instructions for using the Cochrane RoB tool are provided in the Cochrane Handbook for Systematic Reviews of Interventions (The Cochrane Handbook). The purpose of this study was to analyse whether Cochrane authors use adequate judgments about the RoB for random sequence generation of RCTs included in Cochrane reviews. METHODS: We extracted authors’ judgments (high, low or unclear RoB) and supports for judgments (comments accompanying judgments which explain the rationale for a judgment) for random sequence generation of included RCTs from RoB tables of Cochrane reviews using automated data scraping. We categorised all supporting comments, analysed the number and type of various supporting comments and assessed adequacy of RoB judgment for randomisation in line with recommendations from the Cochrane Handbook. RESULTS: We analysed 10,103 RCTs that were included in 704 Cochrane reviews. For 5,706 RCTs, randomisation was not described, but for the remaining RCTs, it was indicated that randomisation was performed using computer/software/internet (N = 2,850), random number table (N = 883), mechanical method (N = 359) or it was incomplete/inappropriate (N = 305). Overall, 1,220/10,103 trials (12%) did not have a RoB judgment in line with Cochrane Handbook guidance about randomisation. The highest proportion of misjudgements was found for trials with high RoB (28%), followed by those with low (20%) or unclear (3%). Therefore, one in eight judgments for the analysed domain in Cochrane reviews was not in line with Cochrane Handbook, and one in four if the judgment was "high risk". CONCLUSION: Authors of Cochrane reviews often make judgments about the RoB related to random sequence generation that are not in line with instructions given in the Cochrane Handbook, which compromises the reliability of the systematic reviews. Our results can help authors of both Cochrane and non-Cochrane reviews which use Cochrane RoB tool to avoid making common mistakes when assessing RoB in included trials. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12874-019-0804-y) contains supplementary material, which is available to authorized users. BioMed Central 2019-08-05 /pmc/articles/PMC6683577/ /pubmed/31382898 http://dx.doi.org/10.1186/s12874-019-0804-y Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Barcot, Ognjen
Boric, Matija
Poklepovic Pericic, Tina
Cavar, Marija
Dosenovic, Svjetlana
Vuka, Ivana
Puljak, Livia
Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook
title Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook
title_full Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook
title_fullStr Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook
title_full_unstemmed Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook
title_short Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook
title_sort risk of bias judgments for random sequence generation in cochrane systematic reviews were frequently not in line with cochrane handbook
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6683577/
https://www.ncbi.nlm.nih.gov/pubmed/31382898
http://dx.doi.org/10.1186/s12874-019-0804-y
work_keys_str_mv AT barcotognjen riskofbiasjudgmentsforrandomsequencegenerationincochranesystematicreviewswerefrequentlynotinlinewithcochranehandbook
AT boricmatija riskofbiasjudgmentsforrandomsequencegenerationincochranesystematicreviewswerefrequentlynotinlinewithcochranehandbook
AT poklepovicpericictina riskofbiasjudgmentsforrandomsequencegenerationincochranesystematicreviewswerefrequentlynotinlinewithcochranehandbook
AT cavarmarija riskofbiasjudgmentsforrandomsequencegenerationincochranesystematicreviewswerefrequentlynotinlinewithcochranehandbook
AT dosenovicsvjetlana riskofbiasjudgmentsforrandomsequencegenerationincochranesystematicreviewswerefrequentlynotinlinewithcochranehandbook
AT vukaivana riskofbiasjudgmentsforrandomsequencegenerationincochranesystematicreviewswerefrequentlynotinlinewithcochranehandbook
AT puljaklivia riskofbiasjudgmentsforrandomsequencegenerationincochranesystematicreviewswerefrequentlynotinlinewithcochranehandbook