Cargando…
Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook
BACKGROUND: Assessing the risk of bias (RoB) in included studies is one of the key methodological aspects of systematic reviews. Cochrane systematic reviews appraise RoB of randomised controlled trials (RCTs) with the Cochrane RoB tool. Detailed instructions for using the Cochrane RoB tool are provi...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6683577/ https://www.ncbi.nlm.nih.gov/pubmed/31382898 http://dx.doi.org/10.1186/s12874-019-0804-y |
_version_ | 1783442124407046144 |
---|---|
author | Barcot, Ognjen Boric, Matija Poklepovic Pericic, Tina Cavar, Marija Dosenovic, Svjetlana Vuka, Ivana Puljak, Livia |
author_facet | Barcot, Ognjen Boric, Matija Poklepovic Pericic, Tina Cavar, Marija Dosenovic, Svjetlana Vuka, Ivana Puljak, Livia |
author_sort | Barcot, Ognjen |
collection | PubMed |
description | BACKGROUND: Assessing the risk of bias (RoB) in included studies is one of the key methodological aspects of systematic reviews. Cochrane systematic reviews appraise RoB of randomised controlled trials (RCTs) with the Cochrane RoB tool. Detailed instructions for using the Cochrane RoB tool are provided in the Cochrane Handbook for Systematic Reviews of Interventions (The Cochrane Handbook). The purpose of this study was to analyse whether Cochrane authors use adequate judgments about the RoB for random sequence generation of RCTs included in Cochrane reviews. METHODS: We extracted authors’ judgments (high, low or unclear RoB) and supports for judgments (comments accompanying judgments which explain the rationale for a judgment) for random sequence generation of included RCTs from RoB tables of Cochrane reviews using automated data scraping. We categorised all supporting comments, analysed the number and type of various supporting comments and assessed adequacy of RoB judgment for randomisation in line with recommendations from the Cochrane Handbook. RESULTS: We analysed 10,103 RCTs that were included in 704 Cochrane reviews. For 5,706 RCTs, randomisation was not described, but for the remaining RCTs, it was indicated that randomisation was performed using computer/software/internet (N = 2,850), random number table (N = 883), mechanical method (N = 359) or it was incomplete/inappropriate (N = 305). Overall, 1,220/10,103 trials (12%) did not have a RoB judgment in line with Cochrane Handbook guidance about randomisation. The highest proportion of misjudgements was found for trials with high RoB (28%), followed by those with low (20%) or unclear (3%). Therefore, one in eight judgments for the analysed domain in Cochrane reviews was not in line with Cochrane Handbook, and one in four if the judgment was "high risk". CONCLUSION: Authors of Cochrane reviews often make judgments about the RoB related to random sequence generation that are not in line with instructions given in the Cochrane Handbook, which compromises the reliability of the systematic reviews. Our results can help authors of both Cochrane and non-Cochrane reviews which use Cochrane RoB tool to avoid making common mistakes when assessing RoB in included trials. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12874-019-0804-y) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-6683577 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-66835772019-08-12 Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook Barcot, Ognjen Boric, Matija Poklepovic Pericic, Tina Cavar, Marija Dosenovic, Svjetlana Vuka, Ivana Puljak, Livia BMC Med Res Methodol Research Article BACKGROUND: Assessing the risk of bias (RoB) in included studies is one of the key methodological aspects of systematic reviews. Cochrane systematic reviews appraise RoB of randomised controlled trials (RCTs) with the Cochrane RoB tool. Detailed instructions for using the Cochrane RoB tool are provided in the Cochrane Handbook for Systematic Reviews of Interventions (The Cochrane Handbook). The purpose of this study was to analyse whether Cochrane authors use adequate judgments about the RoB for random sequence generation of RCTs included in Cochrane reviews. METHODS: We extracted authors’ judgments (high, low or unclear RoB) and supports for judgments (comments accompanying judgments which explain the rationale for a judgment) for random sequence generation of included RCTs from RoB tables of Cochrane reviews using automated data scraping. We categorised all supporting comments, analysed the number and type of various supporting comments and assessed adequacy of RoB judgment for randomisation in line with recommendations from the Cochrane Handbook. RESULTS: We analysed 10,103 RCTs that were included in 704 Cochrane reviews. For 5,706 RCTs, randomisation was not described, but for the remaining RCTs, it was indicated that randomisation was performed using computer/software/internet (N = 2,850), random number table (N = 883), mechanical method (N = 359) or it was incomplete/inappropriate (N = 305). Overall, 1,220/10,103 trials (12%) did not have a RoB judgment in line with Cochrane Handbook guidance about randomisation. The highest proportion of misjudgements was found for trials with high RoB (28%), followed by those with low (20%) or unclear (3%). Therefore, one in eight judgments for the analysed domain in Cochrane reviews was not in line with Cochrane Handbook, and one in four if the judgment was "high risk". CONCLUSION: Authors of Cochrane reviews often make judgments about the RoB related to random sequence generation that are not in line with instructions given in the Cochrane Handbook, which compromises the reliability of the systematic reviews. Our results can help authors of both Cochrane and non-Cochrane reviews which use Cochrane RoB tool to avoid making common mistakes when assessing RoB in included trials. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12874-019-0804-y) contains supplementary material, which is available to authorized users. BioMed Central 2019-08-05 /pmc/articles/PMC6683577/ /pubmed/31382898 http://dx.doi.org/10.1186/s12874-019-0804-y Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Barcot, Ognjen Boric, Matija Poklepovic Pericic, Tina Cavar, Marija Dosenovic, Svjetlana Vuka, Ivana Puljak, Livia Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook |
title | Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook |
title_full | Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook |
title_fullStr | Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook |
title_full_unstemmed | Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook |
title_short | Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook |
title_sort | risk of bias judgments for random sequence generation in cochrane systematic reviews were frequently not in line with cochrane handbook |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6683577/ https://www.ncbi.nlm.nih.gov/pubmed/31382898 http://dx.doi.org/10.1186/s12874-019-0804-y |
work_keys_str_mv | AT barcotognjen riskofbiasjudgmentsforrandomsequencegenerationincochranesystematicreviewswerefrequentlynotinlinewithcochranehandbook AT boricmatija riskofbiasjudgmentsforrandomsequencegenerationincochranesystematicreviewswerefrequentlynotinlinewithcochranehandbook AT poklepovicpericictina riskofbiasjudgmentsforrandomsequencegenerationincochranesystematicreviewswerefrequentlynotinlinewithcochranehandbook AT cavarmarija riskofbiasjudgmentsforrandomsequencegenerationincochranesystematicreviewswerefrequentlynotinlinewithcochranehandbook AT dosenovicsvjetlana riskofbiasjudgmentsforrandomsequencegenerationincochranesystematicreviewswerefrequentlynotinlinewithcochranehandbook AT vukaivana riskofbiasjudgmentsforrandomsequencegenerationincochranesystematicreviewswerefrequentlynotinlinewithcochranehandbook AT puljaklivia riskofbiasjudgmentsforrandomsequencegenerationincochranesystematicreviewswerefrequentlynotinlinewithcochranehandbook |