Cargando…

Paravertebral Mass and Diffuse Lymphadenopathy in a Patient with Pyruvate Kinase Deficiency: Malignancy or Alternative Etiology?

Extramedullary hematopoiesis is common in chronic hemolytic anemias such as pyruvate kinase deficiency. It is commonly associated with hepatosplenomegaly or lymphadenopathy; however, it can rarely also present as a mass in the chest, abdomen, or paraspinal region. Here, we present a case of an adult...

Descripción completa

Detalles Bibliográficos
Autores principales: Shaikh, Hira, Bakalov, Veli, Shaikh, Soorih, Amjad, Ali
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Cureus 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6684121/
https://www.ncbi.nlm.nih.gov/pubmed/31410332
http://dx.doi.org/10.7759/cureus.4849
_version_ 1783442216908226560
author Shaikh, Hira
Bakalov, Veli
Shaikh, Soorih
Amjad, Ali
author_facet Shaikh, Hira
Bakalov, Veli
Shaikh, Soorih
Amjad, Ali
author_sort Shaikh, Hira
collection PubMed
description Extramedullary hematopoiesis is common in chronic hemolytic anemias such as pyruvate kinase deficiency. It is commonly associated with hepatosplenomegaly or lymphadenopathy; however, it can rarely also present as a mass in the chest, abdomen, or paraspinal region. Here, we present a case of an adult patient with pyruvate kinase deficiency and history of splenectomy. He presented with sepsis and brisk leukocytosis secondary to pneumonia and was also found to have diffuse intraabdominal lymphadenopathy along with a paravertebral mass. The radiological findings raised concerns for a systemic lymphoproliferative disorder and there was a suggestion for further workup with a biopsy. However, given the patient’s underlying pyruvate kinase deficiency, we hypothesized that the paravertebral mass is likely a result of extramedullary hematopoiesis in the setting of bone marrow stress from infection and ongoing hemolysis; thus, we decided against biopsy. Repeat imaging six weeks after the presentation showed resolution of the paravertebral mass, which consolidated our hypothesis. This highlights the importance of avoiding invasive diagnostic procedures in asymptomatic patients with chronic hemolysis who may present with diffuse mass lesions.
format Online
Article
Text
id pubmed-6684121
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Cureus
record_format MEDLINE/PubMed
spelling pubmed-66841212019-08-13 Paravertebral Mass and Diffuse Lymphadenopathy in a Patient with Pyruvate Kinase Deficiency: Malignancy or Alternative Etiology? Shaikh, Hira Bakalov, Veli Shaikh, Soorih Amjad, Ali Cureus Radiology Extramedullary hematopoiesis is common in chronic hemolytic anemias such as pyruvate kinase deficiency. It is commonly associated with hepatosplenomegaly or lymphadenopathy; however, it can rarely also present as a mass in the chest, abdomen, or paraspinal region. Here, we present a case of an adult patient with pyruvate kinase deficiency and history of splenectomy. He presented with sepsis and brisk leukocytosis secondary to pneumonia and was also found to have diffuse intraabdominal lymphadenopathy along with a paravertebral mass. The radiological findings raised concerns for a systemic lymphoproliferative disorder and there was a suggestion for further workup with a biopsy. However, given the patient’s underlying pyruvate kinase deficiency, we hypothesized that the paravertebral mass is likely a result of extramedullary hematopoiesis in the setting of bone marrow stress from infection and ongoing hemolysis; thus, we decided against biopsy. Repeat imaging six weeks after the presentation showed resolution of the paravertebral mass, which consolidated our hypothesis. This highlights the importance of avoiding invasive diagnostic procedures in asymptomatic patients with chronic hemolysis who may present with diffuse mass lesions. Cureus 2019-06-06 /pmc/articles/PMC6684121/ /pubmed/31410332 http://dx.doi.org/10.7759/cureus.4849 Text en Copyright © 2019, Shaikh et al. http://creativecommons.org/licenses/by/3.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Radiology
Shaikh, Hira
Bakalov, Veli
Shaikh, Soorih
Amjad, Ali
Paravertebral Mass and Diffuse Lymphadenopathy in a Patient with Pyruvate Kinase Deficiency: Malignancy or Alternative Etiology?
title Paravertebral Mass and Diffuse Lymphadenopathy in a Patient with Pyruvate Kinase Deficiency: Malignancy or Alternative Etiology?
title_full Paravertebral Mass and Diffuse Lymphadenopathy in a Patient with Pyruvate Kinase Deficiency: Malignancy or Alternative Etiology?
title_fullStr Paravertebral Mass and Diffuse Lymphadenopathy in a Patient with Pyruvate Kinase Deficiency: Malignancy or Alternative Etiology?
title_full_unstemmed Paravertebral Mass and Diffuse Lymphadenopathy in a Patient with Pyruvate Kinase Deficiency: Malignancy or Alternative Etiology?
title_short Paravertebral Mass and Diffuse Lymphadenopathy in a Patient with Pyruvate Kinase Deficiency: Malignancy or Alternative Etiology?
title_sort paravertebral mass and diffuse lymphadenopathy in a patient with pyruvate kinase deficiency: malignancy or alternative etiology?
topic Radiology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6684121/
https://www.ncbi.nlm.nih.gov/pubmed/31410332
http://dx.doi.org/10.7759/cureus.4849
work_keys_str_mv AT shaikhhira paravertebralmassanddiffuselymphadenopathyinapatientwithpyruvatekinasedeficiencymalignancyoralternativeetiology
AT bakalovveli paravertebralmassanddiffuselymphadenopathyinapatientwithpyruvatekinasedeficiencymalignancyoralternativeetiology
AT shaikhsoorih paravertebralmassanddiffuselymphadenopathyinapatientwithpyruvatekinasedeficiencymalignancyoralternativeetiology
AT amjadali paravertebralmassanddiffuselymphadenopathyinapatientwithpyruvatekinasedeficiencymalignancyoralternativeetiology