Cargando…
Paravertebral Mass and Diffuse Lymphadenopathy in a Patient with Pyruvate Kinase Deficiency: Malignancy or Alternative Etiology?
Extramedullary hematopoiesis is common in chronic hemolytic anemias such as pyruvate kinase deficiency. It is commonly associated with hepatosplenomegaly or lymphadenopathy; however, it can rarely also present as a mass in the chest, abdomen, or paraspinal region. Here, we present a case of an adult...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Cureus
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6684121/ https://www.ncbi.nlm.nih.gov/pubmed/31410332 http://dx.doi.org/10.7759/cureus.4849 |
_version_ | 1783442216908226560 |
---|---|
author | Shaikh, Hira Bakalov, Veli Shaikh, Soorih Amjad, Ali |
author_facet | Shaikh, Hira Bakalov, Veli Shaikh, Soorih Amjad, Ali |
author_sort | Shaikh, Hira |
collection | PubMed |
description | Extramedullary hematopoiesis is common in chronic hemolytic anemias such as pyruvate kinase deficiency. It is commonly associated with hepatosplenomegaly or lymphadenopathy; however, it can rarely also present as a mass in the chest, abdomen, or paraspinal region. Here, we present a case of an adult patient with pyruvate kinase deficiency and history of splenectomy. He presented with sepsis and brisk leukocytosis secondary to pneumonia and was also found to have diffuse intraabdominal lymphadenopathy along with a paravertebral mass. The radiological findings raised concerns for a systemic lymphoproliferative disorder and there was a suggestion for further workup with a biopsy. However, given the patient’s underlying pyruvate kinase deficiency, we hypothesized that the paravertebral mass is likely a result of extramedullary hematopoiesis in the setting of bone marrow stress from infection and ongoing hemolysis; thus, we decided against biopsy. Repeat imaging six weeks after the presentation showed resolution of the paravertebral mass, which consolidated our hypothesis. This highlights the importance of avoiding invasive diagnostic procedures in asymptomatic patients with chronic hemolysis who may present with diffuse mass lesions. |
format | Online Article Text |
id | pubmed-6684121 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Cureus |
record_format | MEDLINE/PubMed |
spelling | pubmed-66841212019-08-13 Paravertebral Mass and Diffuse Lymphadenopathy in a Patient with Pyruvate Kinase Deficiency: Malignancy or Alternative Etiology? Shaikh, Hira Bakalov, Veli Shaikh, Soorih Amjad, Ali Cureus Radiology Extramedullary hematopoiesis is common in chronic hemolytic anemias such as pyruvate kinase deficiency. It is commonly associated with hepatosplenomegaly or lymphadenopathy; however, it can rarely also present as a mass in the chest, abdomen, or paraspinal region. Here, we present a case of an adult patient with pyruvate kinase deficiency and history of splenectomy. He presented with sepsis and brisk leukocytosis secondary to pneumonia and was also found to have diffuse intraabdominal lymphadenopathy along with a paravertebral mass. The radiological findings raised concerns for a systemic lymphoproliferative disorder and there was a suggestion for further workup with a biopsy. However, given the patient’s underlying pyruvate kinase deficiency, we hypothesized that the paravertebral mass is likely a result of extramedullary hematopoiesis in the setting of bone marrow stress from infection and ongoing hemolysis; thus, we decided against biopsy. Repeat imaging six weeks after the presentation showed resolution of the paravertebral mass, which consolidated our hypothesis. This highlights the importance of avoiding invasive diagnostic procedures in asymptomatic patients with chronic hemolysis who may present with diffuse mass lesions. Cureus 2019-06-06 /pmc/articles/PMC6684121/ /pubmed/31410332 http://dx.doi.org/10.7759/cureus.4849 Text en Copyright © 2019, Shaikh et al. http://creativecommons.org/licenses/by/3.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. |
spellingShingle | Radiology Shaikh, Hira Bakalov, Veli Shaikh, Soorih Amjad, Ali Paravertebral Mass and Diffuse Lymphadenopathy in a Patient with Pyruvate Kinase Deficiency: Malignancy or Alternative Etiology? |
title | Paravertebral Mass and Diffuse Lymphadenopathy in a Patient with Pyruvate Kinase Deficiency: Malignancy or Alternative Etiology? |
title_full | Paravertebral Mass and Diffuse Lymphadenopathy in a Patient with Pyruvate Kinase Deficiency: Malignancy or Alternative Etiology? |
title_fullStr | Paravertebral Mass and Diffuse Lymphadenopathy in a Patient with Pyruvate Kinase Deficiency: Malignancy or Alternative Etiology? |
title_full_unstemmed | Paravertebral Mass and Diffuse Lymphadenopathy in a Patient with Pyruvate Kinase Deficiency: Malignancy or Alternative Etiology? |
title_short | Paravertebral Mass and Diffuse Lymphadenopathy in a Patient with Pyruvate Kinase Deficiency: Malignancy or Alternative Etiology? |
title_sort | paravertebral mass and diffuse lymphadenopathy in a patient with pyruvate kinase deficiency: malignancy or alternative etiology? |
topic | Radiology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6684121/ https://www.ncbi.nlm.nih.gov/pubmed/31410332 http://dx.doi.org/10.7759/cureus.4849 |
work_keys_str_mv | AT shaikhhira paravertebralmassanddiffuselymphadenopathyinapatientwithpyruvatekinasedeficiencymalignancyoralternativeetiology AT bakalovveli paravertebralmassanddiffuselymphadenopathyinapatientwithpyruvatekinasedeficiencymalignancyoralternativeetiology AT shaikhsoorih paravertebralmassanddiffuselymphadenopathyinapatientwithpyruvatekinasedeficiencymalignancyoralternativeetiology AT amjadali paravertebralmassanddiffuselymphadenopathyinapatientwithpyruvatekinasedeficiencymalignancyoralternativeetiology |