Cargando…

Study protocol: Impact of quality improvement interventions on perinatal outcomes in health facilities—a systematic review

BACKGROUND: About 5.8 million maternal deaths, neonatal deaths and stillbirths occur every year with 99% of them taking place in low- and middle-income countries. Two thirds of them could be prevented through cost-effective interventions during pregnancy, intrapartum and postpartum periods. Despite...

Descripción completa

Detalles Bibliográficos
Autores principales: Gurung, Rejina, Zaka, Nabila, Budhathoki, Shyam Sundar, Sunny, Avinash K., Thapa, Jeevan, Zhou, Hong, KC, Ashish
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6694558/
https://www.ncbi.nlm.nih.gov/pubmed/31416483
http://dx.doi.org/10.1186/s13643-019-1110-9
_version_ 1783443849217048576
author Gurung, Rejina
Zaka, Nabila
Budhathoki, Shyam Sundar
Sunny, Avinash K.
Thapa, Jeevan
Zhou, Hong
KC, Ashish
author_facet Gurung, Rejina
Zaka, Nabila
Budhathoki, Shyam Sundar
Sunny, Avinash K.
Thapa, Jeevan
Zhou, Hong
KC, Ashish
author_sort Gurung, Rejina
collection PubMed
description BACKGROUND: About 5.8 million maternal deaths, neonatal deaths and stillbirths occur every year with 99% of them taking place in low- and middle-income countries. Two thirds of them could be prevented through cost-effective interventions during pregnancy, intrapartum and postpartum periods. Despite the availability of standards and guidelines for the care of mother and newborn, challenges remain in translating these standards into practice in health facilities. Although several quality improvement (QI) interventions have been systematically reviewed by the Cochrane Effective Practice and Organization of Care (EPOC) group, evidence lack on QI interventions for improving perinatal outcomes in health facilities. This systematic review will identify QI interventions implemented for maternal and neonatal care in health facilities and their impact on perinatal outcomes. METHODS/DESIGN: This review will look at studies of mothers, newborn and both who received inpatient care at health facilities. QI interventions targeted at health system level (macro), at healthcare organization (meso) and at health workers practice (micro) will be reviewed. Mortality of mothers and newborn and relevant health worker practices will be assessed. The MEDLINE, Embase, World Health Organization Global Health Library, Cochrane Library and trial registries electronic databases will be searched for relevant studies from the year 2000 onwards. Data will be extracted from the identified relevant literature using Epi review software. Risk of bias will be assessed in the studies using the Cochrane risk of bias tool for randomized and observational studies. Standard data synthesis and analysis will be used for the review, and the data will be analysed using EPPI Reviewer 4. DISCUSSION: This review will inform the global agenda for evidence-based health care by (1) providing a basis for operational guidelines for implementing clinical standards of perinatal care, (2) identify research priorities for generating evidence for QI interventions and (3) QI intervention options with lessons learnt for implementation based on the level of needed resources. SYSTEMATIC REVIEW REGISTRATION: PROSPERO registration number CRD42018106075 ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13643-019-1110-9) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-6694558
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-66945582019-08-19 Study protocol: Impact of quality improvement interventions on perinatal outcomes in health facilities—a systematic review Gurung, Rejina Zaka, Nabila Budhathoki, Shyam Sundar Sunny, Avinash K. Thapa, Jeevan Zhou, Hong KC, Ashish Syst Rev Protocol BACKGROUND: About 5.8 million maternal deaths, neonatal deaths and stillbirths occur every year with 99% of them taking place in low- and middle-income countries. Two thirds of them could be prevented through cost-effective interventions during pregnancy, intrapartum and postpartum periods. Despite the availability of standards and guidelines for the care of mother and newborn, challenges remain in translating these standards into practice in health facilities. Although several quality improvement (QI) interventions have been systematically reviewed by the Cochrane Effective Practice and Organization of Care (EPOC) group, evidence lack on QI interventions for improving perinatal outcomes in health facilities. This systematic review will identify QI interventions implemented for maternal and neonatal care in health facilities and their impact on perinatal outcomes. METHODS/DESIGN: This review will look at studies of mothers, newborn and both who received inpatient care at health facilities. QI interventions targeted at health system level (macro), at healthcare organization (meso) and at health workers practice (micro) will be reviewed. Mortality of mothers and newborn and relevant health worker practices will be assessed. The MEDLINE, Embase, World Health Organization Global Health Library, Cochrane Library and trial registries electronic databases will be searched for relevant studies from the year 2000 onwards. Data will be extracted from the identified relevant literature using Epi review software. Risk of bias will be assessed in the studies using the Cochrane risk of bias tool for randomized and observational studies. Standard data synthesis and analysis will be used for the review, and the data will be analysed using EPPI Reviewer 4. DISCUSSION: This review will inform the global agenda for evidence-based health care by (1) providing a basis for operational guidelines for implementing clinical standards of perinatal care, (2) identify research priorities for generating evidence for QI interventions and (3) QI intervention options with lessons learnt for implementation based on the level of needed resources. SYSTEMATIC REVIEW REGISTRATION: PROSPERO registration number CRD42018106075 ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13643-019-1110-9) contains supplementary material, which is available to authorized users. BioMed Central 2019-08-15 /pmc/articles/PMC6694558/ /pubmed/31416483 http://dx.doi.org/10.1186/s13643-019-1110-9 Text en © The Author(s). 2019 Open Access This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Protocol
Gurung, Rejina
Zaka, Nabila
Budhathoki, Shyam Sundar
Sunny, Avinash K.
Thapa, Jeevan
Zhou, Hong
KC, Ashish
Study protocol: Impact of quality improvement interventions on perinatal outcomes in health facilities—a systematic review
title Study protocol: Impact of quality improvement interventions on perinatal outcomes in health facilities—a systematic review
title_full Study protocol: Impact of quality improvement interventions on perinatal outcomes in health facilities—a systematic review
title_fullStr Study protocol: Impact of quality improvement interventions on perinatal outcomes in health facilities—a systematic review
title_full_unstemmed Study protocol: Impact of quality improvement interventions on perinatal outcomes in health facilities—a systematic review
title_short Study protocol: Impact of quality improvement interventions on perinatal outcomes in health facilities—a systematic review
title_sort study protocol: impact of quality improvement interventions on perinatal outcomes in health facilities—a systematic review
topic Protocol
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6694558/
https://www.ncbi.nlm.nih.gov/pubmed/31416483
http://dx.doi.org/10.1186/s13643-019-1110-9
work_keys_str_mv AT gurungrejina studyprotocolimpactofqualityimprovementinterventionsonperinataloutcomesinhealthfacilitiesasystematicreview
AT zakanabila studyprotocolimpactofqualityimprovementinterventionsonperinataloutcomesinhealthfacilitiesasystematicreview
AT budhathokishyamsundar studyprotocolimpactofqualityimprovementinterventionsonperinataloutcomesinhealthfacilitiesasystematicreview
AT sunnyavinashk studyprotocolimpactofqualityimprovementinterventionsonperinataloutcomesinhealthfacilitiesasystematicreview
AT thapajeevan studyprotocolimpactofqualityimprovementinterventionsonperinataloutcomesinhealthfacilitiesasystematicreview
AT zhouhong studyprotocolimpactofqualityimprovementinterventionsonperinataloutcomesinhealthfacilitiesasystematicreview
AT kcashish studyprotocolimpactofqualityimprovementinterventionsonperinataloutcomesinhealthfacilitiesasystematicreview