Cargando…

Structural and functional characterization of a novel cold-active S-formylglutathione hydrolase (SfSFGH) homolog from Shewanella frigidimarina, a psychrophilic bacterium

BACKGROUND: S-Formylglutathione is hydrolyzed to glutathione and formate by an S-formylglutathione hydrolase (SFGH) (3.1.2.12). This thiol esterase belongs to the esterase family and is also known as esterase D. SFGHs contain highly conserved active residues of Ser-Asp-His as a catalytic triad at th...

Descripción completa

Detalles Bibliográficos
Autores principales: Lee, Chang Woo, Yoo, Wanki, Park, Sun-Ha, Le, Ly Thi Huong Luu, Jeong, Chang-Sook, Ryu, Bum Han, Shin, Seung Chul, Kim, Han-Woo, Park, Hyun, Kim, Kyeong Kyu, Kim, T. Doohun, Lee, Jun Hyuck
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6699074/
https://www.ncbi.nlm.nih.gov/pubmed/31426813
http://dx.doi.org/10.1186/s12934-019-1190-1
_version_ 1783444656935141376
author Lee, Chang Woo
Yoo, Wanki
Park, Sun-Ha
Le, Ly Thi Huong Luu
Jeong, Chang-Sook
Ryu, Bum Han
Shin, Seung Chul
Kim, Han-Woo
Park, Hyun
Kim, Kyeong Kyu
Kim, T. Doohun
Lee, Jun Hyuck
author_facet Lee, Chang Woo
Yoo, Wanki
Park, Sun-Ha
Le, Ly Thi Huong Luu
Jeong, Chang-Sook
Ryu, Bum Han
Shin, Seung Chul
Kim, Han-Woo
Park, Hyun
Kim, Kyeong Kyu
Kim, T. Doohun
Lee, Jun Hyuck
author_sort Lee, Chang Woo
collection PubMed
description BACKGROUND: S-Formylglutathione is hydrolyzed to glutathione and formate by an S-formylglutathione hydrolase (SFGH) (3.1.2.12). This thiol esterase belongs to the esterase family and is also known as esterase D. SFGHs contain highly conserved active residues of Ser-Asp-His as a catalytic triad at the active site. Characterization and investigation of SFGH from Antarctic organisms at the molecular level is needed for industrial use through protein engineering. RESULTS: A novel cold-active S-formylglutathione hydrolase (SfSFGH) from Shewanella frigidimarina, composed of 279 amino acids with a molecular mass of ~ 31.0 kDa, was characterized. Sequence analysis of SfSFGH revealed a conserved pentapeptide of G-X-S-X-G found in various lipolytic enzymes along with a putative catalytic triad of Ser148-Asp224-His257. Activity analysis showed that SfSFGH was active towards short-chain esters, such as p-nitrophenyl acetate, butyrate, hexanoate, and octanoate. The optimum pH for enzymatic activity was slightly alkaline (pH 8.0). To investigate the active site configuration of SfSFGH, we determined the crystal structure of SfSFGH at 2.32 Å resolution. Structural analysis shows that a Trp182 residue is located at the active site entrance, allowing it to act as a gatekeeper residue to control substrate binding to SfSFGH. Moreover, SfSFGH displayed more than 50% of its initial activity in the presence of various chemicals, including 30% EtOH, 1% Triton X-100, 1% SDS, and 5 M urea. CONCLUSIONS: Mutation of Trp182 to Ala allowed SfSFGH to accommodate a longer chain of substrates. It is thought that the W182A mutation increases the substrate-binding pocket and decreases the steric effect for larger substrates in SfSFGH. Consequently, the W182A mutant has a broader substrate specificity compared to wild-type SfSFGH. Taken together, this study provides useful structure–function data of a SFGH family member and may inform protein engineering strategies for industrial applications of SfSFGH. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12934-019-1190-1) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-6699074
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-66990742019-08-26 Structural and functional characterization of a novel cold-active S-formylglutathione hydrolase (SfSFGH) homolog from Shewanella frigidimarina, a psychrophilic bacterium Lee, Chang Woo Yoo, Wanki Park, Sun-Ha Le, Ly Thi Huong Luu Jeong, Chang-Sook Ryu, Bum Han Shin, Seung Chul Kim, Han-Woo Park, Hyun Kim, Kyeong Kyu Kim, T. Doohun Lee, Jun Hyuck Microb Cell Fact Research BACKGROUND: S-Formylglutathione is hydrolyzed to glutathione and formate by an S-formylglutathione hydrolase (SFGH) (3.1.2.12). This thiol esterase belongs to the esterase family and is also known as esterase D. SFGHs contain highly conserved active residues of Ser-Asp-His as a catalytic triad at the active site. Characterization and investigation of SFGH from Antarctic organisms at the molecular level is needed for industrial use through protein engineering. RESULTS: A novel cold-active S-formylglutathione hydrolase (SfSFGH) from Shewanella frigidimarina, composed of 279 amino acids with a molecular mass of ~ 31.0 kDa, was characterized. Sequence analysis of SfSFGH revealed a conserved pentapeptide of G-X-S-X-G found in various lipolytic enzymes along with a putative catalytic triad of Ser148-Asp224-His257. Activity analysis showed that SfSFGH was active towards short-chain esters, such as p-nitrophenyl acetate, butyrate, hexanoate, and octanoate. The optimum pH for enzymatic activity was slightly alkaline (pH 8.0). To investigate the active site configuration of SfSFGH, we determined the crystal structure of SfSFGH at 2.32 Å resolution. Structural analysis shows that a Trp182 residue is located at the active site entrance, allowing it to act as a gatekeeper residue to control substrate binding to SfSFGH. Moreover, SfSFGH displayed more than 50% of its initial activity in the presence of various chemicals, including 30% EtOH, 1% Triton X-100, 1% SDS, and 5 M urea. CONCLUSIONS: Mutation of Trp182 to Ala allowed SfSFGH to accommodate a longer chain of substrates. It is thought that the W182A mutation increases the substrate-binding pocket and decreases the steric effect for larger substrates in SfSFGH. Consequently, the W182A mutant has a broader substrate specificity compared to wild-type SfSFGH. Taken together, this study provides useful structure–function data of a SFGH family member and may inform protein engineering strategies for industrial applications of SfSFGH. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12934-019-1190-1) contains supplementary material, which is available to authorized users. BioMed Central 2019-08-19 /pmc/articles/PMC6699074/ /pubmed/31426813 http://dx.doi.org/10.1186/s12934-019-1190-1 Text en © The Author(s) 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Lee, Chang Woo
Yoo, Wanki
Park, Sun-Ha
Le, Ly Thi Huong Luu
Jeong, Chang-Sook
Ryu, Bum Han
Shin, Seung Chul
Kim, Han-Woo
Park, Hyun
Kim, Kyeong Kyu
Kim, T. Doohun
Lee, Jun Hyuck
Structural and functional characterization of a novel cold-active S-formylglutathione hydrolase (SfSFGH) homolog from Shewanella frigidimarina, a psychrophilic bacterium
title Structural and functional characterization of a novel cold-active S-formylglutathione hydrolase (SfSFGH) homolog from Shewanella frigidimarina, a psychrophilic bacterium
title_full Structural and functional characterization of a novel cold-active S-formylglutathione hydrolase (SfSFGH) homolog from Shewanella frigidimarina, a psychrophilic bacterium
title_fullStr Structural and functional characterization of a novel cold-active S-formylglutathione hydrolase (SfSFGH) homolog from Shewanella frigidimarina, a psychrophilic bacterium
title_full_unstemmed Structural and functional characterization of a novel cold-active S-formylglutathione hydrolase (SfSFGH) homolog from Shewanella frigidimarina, a psychrophilic bacterium
title_short Structural and functional characterization of a novel cold-active S-formylglutathione hydrolase (SfSFGH) homolog from Shewanella frigidimarina, a psychrophilic bacterium
title_sort structural and functional characterization of a novel cold-active s-formylglutathione hydrolase (sfsfgh) homolog from shewanella frigidimarina, a psychrophilic bacterium
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6699074/
https://www.ncbi.nlm.nih.gov/pubmed/31426813
http://dx.doi.org/10.1186/s12934-019-1190-1
work_keys_str_mv AT leechangwoo structuralandfunctionalcharacterizationofanovelcoldactivesformylglutathionehydrolasesfsfghhomologfromshewanellafrigidimarinaapsychrophilicbacterium
AT yoowanki structuralandfunctionalcharacterizationofanovelcoldactivesformylglutathionehydrolasesfsfghhomologfromshewanellafrigidimarinaapsychrophilicbacterium
AT parksunha structuralandfunctionalcharacterizationofanovelcoldactivesformylglutathionehydrolasesfsfghhomologfromshewanellafrigidimarinaapsychrophilicbacterium
AT lelythihuongluu structuralandfunctionalcharacterizationofanovelcoldactivesformylglutathionehydrolasesfsfghhomologfromshewanellafrigidimarinaapsychrophilicbacterium
AT jeongchangsook structuralandfunctionalcharacterizationofanovelcoldactivesformylglutathionehydrolasesfsfghhomologfromshewanellafrigidimarinaapsychrophilicbacterium
AT ryubumhan structuralandfunctionalcharacterizationofanovelcoldactivesformylglutathionehydrolasesfsfghhomologfromshewanellafrigidimarinaapsychrophilicbacterium
AT shinseungchul structuralandfunctionalcharacterizationofanovelcoldactivesformylglutathionehydrolasesfsfghhomologfromshewanellafrigidimarinaapsychrophilicbacterium
AT kimhanwoo structuralandfunctionalcharacterizationofanovelcoldactivesformylglutathionehydrolasesfsfghhomologfromshewanellafrigidimarinaapsychrophilicbacterium
AT parkhyun structuralandfunctionalcharacterizationofanovelcoldactivesformylglutathionehydrolasesfsfghhomologfromshewanellafrigidimarinaapsychrophilicbacterium
AT kimkyeongkyu structuralandfunctionalcharacterizationofanovelcoldactivesformylglutathionehydrolasesfsfghhomologfromshewanellafrigidimarinaapsychrophilicbacterium
AT kimtdoohun structuralandfunctionalcharacterizationofanovelcoldactivesformylglutathionehydrolasesfsfghhomologfromshewanellafrigidimarinaapsychrophilicbacterium
AT leejunhyuck structuralandfunctionalcharacterizationofanovelcoldactivesformylglutathionehydrolasesfsfghhomologfromshewanellafrigidimarinaapsychrophilicbacterium