Cargando…

Epidemiology and utilization of primary health care services in Qatar by asthmatic children 5–12 years old: secondary data analysis 2016–2017

BACKGROUND: Childhood asthma is a growing clinical problem and a burden on the health care system due to repetitive visits to children’s emergency departments and frequent hospital admissions where it is poorly controlled. Due to lack of reliable baseline information on its prevalence among children...

Descripción completa

Detalles Bibliográficos
Autores principales: Veettil, Shajitha Thekke, Alnuaimi, Ahmed Sameer AbdulHameed
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6700832/
https://www.ncbi.nlm.nih.gov/pubmed/31452904
http://dx.doi.org/10.1186/s40733-019-0050-4
_version_ 1783444941682245632
author Veettil, Shajitha Thekke
Alnuaimi, Ahmed Sameer AbdulHameed
author_facet Veettil, Shajitha Thekke
Alnuaimi, Ahmed Sameer AbdulHameed
author_sort Veettil, Shajitha Thekke
collection PubMed
description BACKGROUND: Childhood asthma is a growing clinical problem and a burden on the health care system due to repetitive visits to children’s emergency departments and frequent hospital admissions where it is poorly controlled. Due to lack of reliable baseline information on its prevalence among children in Qatar and the extent of their utilization of primary health care services, we sought to analyse electronic medical records data for children aged 5–12 years. OBJECTIVES: Our primary objective was to establish point prevalence over the period 2016–2017. Furthermore, we wanted to assess the frequency and pattern of use of the primary care services including any demographic and seasonal variations, the types of clinical encounter and treatment received. METHODS: A cross sectional study on 54,704 clinical encounters of electronic health records for children aged 5 to 12 years in which a diagnosis of Asthma was tagged during a two years period. RESULTS: The prevalence rate of Asthma out of total registered clients in the specified pediatric age group (196,557) is 6.1%. The rate was highest (10.2%) in youngest age group (5–6 years old) and lowest (4.1%) in teenagers (10–12 years old). An obvious peak of clinical encounters of Asthma cases was observed in Oct and Nov. The work load in PHCC clinics for Asthma clinical encounters is increased by more than 50% compared to the average monthly count of 4556.Moreover, the rate was higher in males (7.6%) compared to females (4.6%). The most frequently prescribed medication group was antihistamine (57.8%) followed by adrenergic bronchodilators (33.9%). CONCLUSIONS: Asthma constitutes an important part (8.5%) of the total primary care clinic work load among children aged 5–12 years in Qatar. A guideline need to encourage physician to use preventive Asthma strategies including steroid medications to provide continuity of care for Asthma cases.
format Online
Article
Text
id pubmed-6700832
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-67008322019-08-26 Epidemiology and utilization of primary health care services in Qatar by asthmatic children 5–12 years old: secondary data analysis 2016–2017 Veettil, Shajitha Thekke Alnuaimi, Ahmed Sameer AbdulHameed Asthma Res Pract Research BACKGROUND: Childhood asthma is a growing clinical problem and a burden on the health care system due to repetitive visits to children’s emergency departments and frequent hospital admissions where it is poorly controlled. Due to lack of reliable baseline information on its prevalence among children in Qatar and the extent of their utilization of primary health care services, we sought to analyse electronic medical records data for children aged 5–12 years. OBJECTIVES: Our primary objective was to establish point prevalence over the period 2016–2017. Furthermore, we wanted to assess the frequency and pattern of use of the primary care services including any demographic and seasonal variations, the types of clinical encounter and treatment received. METHODS: A cross sectional study on 54,704 clinical encounters of electronic health records for children aged 5 to 12 years in which a diagnosis of Asthma was tagged during a two years period. RESULTS: The prevalence rate of Asthma out of total registered clients in the specified pediatric age group (196,557) is 6.1%. The rate was highest (10.2%) in youngest age group (5–6 years old) and lowest (4.1%) in teenagers (10–12 years old). An obvious peak of clinical encounters of Asthma cases was observed in Oct and Nov. The work load in PHCC clinics for Asthma clinical encounters is increased by more than 50% compared to the average monthly count of 4556.Moreover, the rate was higher in males (7.6%) compared to females (4.6%). The most frequently prescribed medication group was antihistamine (57.8%) followed by adrenergic bronchodilators (33.9%). CONCLUSIONS: Asthma constitutes an important part (8.5%) of the total primary care clinic work load among children aged 5–12 years in Qatar. A guideline need to encourage physician to use preventive Asthma strategies including steroid medications to provide continuity of care for Asthma cases. BioMed Central 2019-08-20 /pmc/articles/PMC6700832/ /pubmed/31452904 http://dx.doi.org/10.1186/s40733-019-0050-4 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Veettil, Shajitha Thekke
Alnuaimi, Ahmed Sameer AbdulHameed
Epidemiology and utilization of primary health care services in Qatar by asthmatic children 5–12 years old: secondary data analysis 2016–2017
title Epidemiology and utilization of primary health care services in Qatar by asthmatic children 5–12 years old: secondary data analysis 2016–2017
title_full Epidemiology and utilization of primary health care services in Qatar by asthmatic children 5–12 years old: secondary data analysis 2016–2017
title_fullStr Epidemiology and utilization of primary health care services in Qatar by asthmatic children 5–12 years old: secondary data analysis 2016–2017
title_full_unstemmed Epidemiology and utilization of primary health care services in Qatar by asthmatic children 5–12 years old: secondary data analysis 2016–2017
title_short Epidemiology and utilization of primary health care services in Qatar by asthmatic children 5–12 years old: secondary data analysis 2016–2017
title_sort epidemiology and utilization of primary health care services in qatar by asthmatic children 5–12 years old: secondary data analysis 2016–2017
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6700832/
https://www.ncbi.nlm.nih.gov/pubmed/31452904
http://dx.doi.org/10.1186/s40733-019-0050-4
work_keys_str_mv AT veettilshajithathekke epidemiologyandutilizationofprimaryhealthcareservicesinqatarbyasthmaticchildren512yearsoldsecondarydataanalysis20162017
AT alnuaimiahmedsameerabdulhameed epidemiologyandutilizationofprimaryhealthcareservicesinqatarbyasthmaticchildren512yearsoldsecondarydataanalysis20162017