Cargando…

Participation in the state led ‘Janani Sahayogi Yojana’ public private partnership program to promote facility births in Madhya Pradesh, India: views from private obstetrician partners

BACKGROUND: In Madhya Pradesh, India, the government invited private obstetric hospitals for partnership to provide intrapartum care to poor women, paid for by the state. This statewide program, the Janani Sahayogi Yojana (JShY or maternal support scheme), ran from 2006 to 2012. The partnership was...

Descripción completa

Detalles Bibliográficos
Autores principales: Diwan, Vishal, Joshi, Sudhir Chandra, Jehan, Kate, De Costa, Ayesha
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6708218/
https://www.ncbi.nlm.nih.gov/pubmed/31445513
http://dx.doi.org/10.1186/s12913-019-4409-2
_version_ 1783445977810599936
author Diwan, Vishal
Joshi, Sudhir Chandra
Jehan, Kate
De Costa, Ayesha
author_facet Diwan, Vishal
Joshi, Sudhir Chandra
Jehan, Kate
De Costa, Ayesha
author_sort Diwan, Vishal
collection PubMed
description BACKGROUND: In Madhya Pradesh, India, the government invited private obstetric hospitals for partnership to provide intrapartum care to poor women, paid for by the state. This statewide program, the Janani Sahayogi Yojana (JShY or maternal support scheme), ran from 2006 to 2012. The partnership was an uneasy one with many private obstetricians choosing to leave the partnership. This paper explores the motives of private obstetricians in the state for participating in the JShY, their experiences within the partnership, their interactions with the state and motives for withdrawal among those who withdrew from the scheme. This study sheds light on the dynamics of a public-private partnership for obstetric care from the perspective of private sector obstetricians. METHOD: Fifteen in-depth interviews were conducted with private obstetricians and hospital administrators from eight districts of Madhya Pradesh who had participated in the JShY. A Framework approach was used to analyze the data. RESULTS: Private obstetricians reported entering the JShY partnership for altruistic reasons but also as way of expanding their practices and reputations. They perceived that although their facilities provided better quality of care than state facilities, participation was risky because beneficiaries were often unbooked and seen as ‘high risk’ cases. The need to arrange for blood transfusions for these high risk women was perceived as particularly difficult. Cumbersome paper work and delays in receiving payments from the state also dissuaded participation. Some participants felt that there was inadequate engagement by the state, and better monitoring and supervision would have helped. The state changed the financial reimbursement arrangements due to a high proportion of Cesarean births in the early years of the partnership, as these were perversely incentivized. This change resulted in a large exodus of private obstetricians from the partnership. CONCLUSION: This study highlights the contribution of cumbersome processes, trust deficits and a lack of dialogue between public and private partners. Input from both public and private sectors into the design of a carefully thought through financial reimbursement package for private partners was highlighted as a necessary component for future success of such schemes. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12913-019-4409-2) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-6708218
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-67082182019-08-28 Participation in the state led ‘Janani Sahayogi Yojana’ public private partnership program to promote facility births in Madhya Pradesh, India: views from private obstetrician partners Diwan, Vishal Joshi, Sudhir Chandra Jehan, Kate De Costa, Ayesha BMC Health Serv Res Research Article BACKGROUND: In Madhya Pradesh, India, the government invited private obstetric hospitals for partnership to provide intrapartum care to poor women, paid for by the state. This statewide program, the Janani Sahayogi Yojana (JShY or maternal support scheme), ran from 2006 to 2012. The partnership was an uneasy one with many private obstetricians choosing to leave the partnership. This paper explores the motives of private obstetricians in the state for participating in the JShY, their experiences within the partnership, their interactions with the state and motives for withdrawal among those who withdrew from the scheme. This study sheds light on the dynamics of a public-private partnership for obstetric care from the perspective of private sector obstetricians. METHOD: Fifteen in-depth interviews were conducted with private obstetricians and hospital administrators from eight districts of Madhya Pradesh who had participated in the JShY. A Framework approach was used to analyze the data. RESULTS: Private obstetricians reported entering the JShY partnership for altruistic reasons but also as way of expanding their practices and reputations. They perceived that although their facilities provided better quality of care than state facilities, participation was risky because beneficiaries were often unbooked and seen as ‘high risk’ cases. The need to arrange for blood transfusions for these high risk women was perceived as particularly difficult. Cumbersome paper work and delays in receiving payments from the state also dissuaded participation. Some participants felt that there was inadequate engagement by the state, and better monitoring and supervision would have helped. The state changed the financial reimbursement arrangements due to a high proportion of Cesarean births in the early years of the partnership, as these were perversely incentivized. This change resulted in a large exodus of private obstetricians from the partnership. CONCLUSION: This study highlights the contribution of cumbersome processes, trust deficits and a lack of dialogue between public and private partners. Input from both public and private sectors into the design of a carefully thought through financial reimbursement package for private partners was highlighted as a necessary component for future success of such schemes. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12913-019-4409-2) contains supplementary material, which is available to authorized users. BioMed Central 2019-08-24 /pmc/articles/PMC6708218/ /pubmed/31445513 http://dx.doi.org/10.1186/s12913-019-4409-2 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Diwan, Vishal
Joshi, Sudhir Chandra
Jehan, Kate
De Costa, Ayesha
Participation in the state led ‘Janani Sahayogi Yojana’ public private partnership program to promote facility births in Madhya Pradesh, India: views from private obstetrician partners
title Participation in the state led ‘Janani Sahayogi Yojana’ public private partnership program to promote facility births in Madhya Pradesh, India: views from private obstetrician partners
title_full Participation in the state led ‘Janani Sahayogi Yojana’ public private partnership program to promote facility births in Madhya Pradesh, India: views from private obstetrician partners
title_fullStr Participation in the state led ‘Janani Sahayogi Yojana’ public private partnership program to promote facility births in Madhya Pradesh, India: views from private obstetrician partners
title_full_unstemmed Participation in the state led ‘Janani Sahayogi Yojana’ public private partnership program to promote facility births in Madhya Pradesh, India: views from private obstetrician partners
title_short Participation in the state led ‘Janani Sahayogi Yojana’ public private partnership program to promote facility births in Madhya Pradesh, India: views from private obstetrician partners
title_sort participation in the state led ‘janani sahayogi yojana’ public private partnership program to promote facility births in madhya pradesh, india: views from private obstetrician partners
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6708218/
https://www.ncbi.nlm.nih.gov/pubmed/31445513
http://dx.doi.org/10.1186/s12913-019-4409-2
work_keys_str_mv AT diwanvishal participationinthestateledjananisahayogiyojanapublicprivatepartnershipprogramtopromotefacilitybirthsinmadhyapradeshindiaviewsfromprivateobstetricianpartners
AT joshisudhirchandra participationinthestateledjananisahayogiyojanapublicprivatepartnershipprogramtopromotefacilitybirthsinmadhyapradeshindiaviewsfromprivateobstetricianpartners
AT jehankate participationinthestateledjananisahayogiyojanapublicprivatepartnershipprogramtopromotefacilitybirthsinmadhyapradeshindiaviewsfromprivateobstetricianpartners
AT decostaayesha participationinthestateledjananisahayogiyojanapublicprivatepartnershipprogramtopromotefacilitybirthsinmadhyapradeshindiaviewsfromprivateobstetricianpartners