Cargando…
Author Correction: Urinary CE-MS peptide marker pattern for detection of solid tumors
| Autores principales: | , , , , , , , , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
Nature Publishing Group UK
2019
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6718396/ https://www.ncbi.nlm.nih.gov/pubmed/31477787 http://dx.doi.org/10.1038/s41598-019-49304-9 |
| _version_ | 1783447717447467008 |
|---|---|
| author | Belczacka, Iwona Latosinska, Agnieszka Siwy, Justyna Metzger, Jochen Merseburger, Axel S. Mischak, Harald Vlahou, Antonia Frantzi, Maria Jankowski, Vera |
| author_facet | Belczacka, Iwona Latosinska, Agnieszka Siwy, Justyna Metzger, Jochen Merseburger, Axel S. Mischak, Harald Vlahou, Antonia Frantzi, Maria Jankowski, Vera |
| author_sort | Belczacka, Iwona |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-6718396 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2019 |
| publisher | Nature Publishing Group UK |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-67183962019-09-17 Author Correction: Urinary CE-MS peptide marker pattern for detection of solid tumors Belczacka, Iwona Latosinska, Agnieszka Siwy, Justyna Metzger, Jochen Merseburger, Axel S. Mischak, Harald Vlahou, Antonia Frantzi, Maria Jankowski, Vera Sci Rep Author Correction Nature Publishing Group UK 2019-09-03 /pmc/articles/PMC6718396/ /pubmed/31477787 http://dx.doi.org/10.1038/s41598-019-49304-9 Text en © The Author(s) 2019 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/. |
| spellingShingle | Author Correction Belczacka, Iwona Latosinska, Agnieszka Siwy, Justyna Metzger, Jochen Merseburger, Axel S. Mischak, Harald Vlahou, Antonia Frantzi, Maria Jankowski, Vera Author Correction: Urinary CE-MS peptide marker pattern for detection of solid tumors |
| title | Author Correction: Urinary CE-MS peptide marker pattern for detection of solid tumors |
| title_full | Author Correction: Urinary CE-MS peptide marker pattern for detection of solid tumors |
| title_fullStr | Author Correction: Urinary CE-MS peptide marker pattern for detection of solid tumors |
| title_full_unstemmed | Author Correction: Urinary CE-MS peptide marker pattern for detection of solid tumors |
| title_short | Author Correction: Urinary CE-MS peptide marker pattern for detection of solid tumors |
| title_sort | author correction: urinary ce-ms peptide marker pattern for detection of solid tumors |
| topic | Author Correction |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6718396/ https://www.ncbi.nlm.nih.gov/pubmed/31477787 http://dx.doi.org/10.1038/s41598-019-49304-9 |
| work_keys_str_mv | AT belczackaiwona authorcorrectionurinarycemspeptidemarkerpatternfordetectionofsolidtumors AT latosinskaagnieszka authorcorrectionurinarycemspeptidemarkerpatternfordetectionofsolidtumors AT siwyjustyna authorcorrectionurinarycemspeptidemarkerpatternfordetectionofsolidtumors AT metzgerjochen authorcorrectionurinarycemspeptidemarkerpatternfordetectionofsolidtumors AT merseburgeraxels authorcorrectionurinarycemspeptidemarkerpatternfordetectionofsolidtumors AT mischakharald authorcorrectionurinarycemspeptidemarkerpatternfordetectionofsolidtumors AT vlahouantonia authorcorrectionurinarycemspeptidemarkerpatternfordetectionofsolidtumors AT frantzimaria authorcorrectionurinarycemspeptidemarkerpatternfordetectionofsolidtumors AT jankowskivera authorcorrectionurinarycemspeptidemarkerpatternfordetectionofsolidtumors |