Cargando…
Prevalence of kidney damage in Chinese elderly: a large-scale population-based study
BACKGROUND: In China, both population aging and kidney damage has become emerging public health challenges. Despite the number of elders is huge, data on kidney damage in this population are scarce. The present study aimed to describe the prevalence of kidney damage among older adults in Wuhan, Chin...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6719360/ https://www.ncbi.nlm.nih.gov/pubmed/31477037 http://dx.doi.org/10.1186/s12882-019-1525-5 |
_version_ | 1783447916356042752 |
---|---|
author | Wei, Honglan Yan, Yaqiong Gong, Jie Dong, Junwu |
author_facet | Wei, Honglan Yan, Yaqiong Gong, Jie Dong, Junwu |
author_sort | Wei, Honglan |
collection | PubMed |
description | BACKGROUND: In China, both population aging and kidney damage has become emerging public health challenges. Despite the number of elders is huge, data on kidney damage in this population are scarce. The present study aimed to describe the prevalence of kidney damage among older adults in Wuhan, China. METHODS: To describe the prevalence of kidney damage among Chinese elderly, the health screening data of 350,881 adults older than 65 years in Wuhan, China were collected and analyzed. Kidney damage was defined as eGFR less than 60 mL/min per 1·73 m(2) or the presence of proteinuria. Decreased renal function was defined as an eGFR < 60 mL/min/1.73 m(2). Proteinuria was defined as urine protein ≥1+ and without urine WBC or nitrite positive. The associated risk factors of eGFR decline and kidney damage were analyzed by multivariate logistic regression. RESULTS: The age-standardized prevalence of kidney damage, decreased renal function and proteinuria was 17.2, 13.5 and 5.3%. Among the patients, up to 74.4% was stage 3. The prevalence of kidney damage and eGFR decline were higher in suburbs than in urban (18.3% vs 16.0 and 14.6% vs 12.4%). Factors independently associated with kidney damage were age, female, BMI, abdominal circumference, hypertension, diabetes, stroke and coronary heart disease. CONCLUSIONS: Kidney damage has become an important public health problem in Chinese elderly. More attention should be paid to elderly lived in suburbs or rural area in our further work. |
format | Online Article Text |
id | pubmed-6719360 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-67193602019-09-06 Prevalence of kidney damage in Chinese elderly: a large-scale population-based study Wei, Honglan Yan, Yaqiong Gong, Jie Dong, Junwu BMC Nephrol Research Article BACKGROUND: In China, both population aging and kidney damage has become emerging public health challenges. Despite the number of elders is huge, data on kidney damage in this population are scarce. The present study aimed to describe the prevalence of kidney damage among older adults in Wuhan, China. METHODS: To describe the prevalence of kidney damage among Chinese elderly, the health screening data of 350,881 adults older than 65 years in Wuhan, China were collected and analyzed. Kidney damage was defined as eGFR less than 60 mL/min per 1·73 m(2) or the presence of proteinuria. Decreased renal function was defined as an eGFR < 60 mL/min/1.73 m(2). Proteinuria was defined as urine protein ≥1+ and without urine WBC or nitrite positive. The associated risk factors of eGFR decline and kidney damage were analyzed by multivariate logistic regression. RESULTS: The age-standardized prevalence of kidney damage, decreased renal function and proteinuria was 17.2, 13.5 and 5.3%. Among the patients, up to 74.4% was stage 3. The prevalence of kidney damage and eGFR decline were higher in suburbs than in urban (18.3% vs 16.0 and 14.6% vs 12.4%). Factors independently associated with kidney damage were age, female, BMI, abdominal circumference, hypertension, diabetes, stroke and coronary heart disease. CONCLUSIONS: Kidney damage has become an important public health problem in Chinese elderly. More attention should be paid to elderly lived in suburbs or rural area in our further work. BioMed Central 2019-09-02 /pmc/articles/PMC6719360/ /pubmed/31477037 http://dx.doi.org/10.1186/s12882-019-1525-5 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Wei, Honglan Yan, Yaqiong Gong, Jie Dong, Junwu Prevalence of kidney damage in Chinese elderly: a large-scale population-based study |
title | Prevalence of kidney damage in Chinese elderly: a large-scale population-based study |
title_full | Prevalence of kidney damage in Chinese elderly: a large-scale population-based study |
title_fullStr | Prevalence of kidney damage in Chinese elderly: a large-scale population-based study |
title_full_unstemmed | Prevalence of kidney damage in Chinese elderly: a large-scale population-based study |
title_short | Prevalence of kidney damage in Chinese elderly: a large-scale population-based study |
title_sort | prevalence of kidney damage in chinese elderly: a large-scale population-based study |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6719360/ https://www.ncbi.nlm.nih.gov/pubmed/31477037 http://dx.doi.org/10.1186/s12882-019-1525-5 |
work_keys_str_mv | AT weihonglan prevalenceofkidneydamageinchineseelderlyalargescalepopulationbasedstudy AT yanyaqiong prevalenceofkidneydamageinchineseelderlyalargescalepopulationbasedstudy AT gongjie prevalenceofkidneydamageinchineseelderlyalargescalepopulationbasedstudy AT dongjunwu prevalenceofkidneydamageinchineseelderlyalargescalepopulationbasedstudy |