Cargando…
Choice of crystalloid fluid in the treatment of hyperglycemic emergencies: a systematic review protocol
BACKGROUND: Diabetic ketoacidosis (DKA) and hyperglycemic hyperosmolar state (HHS) are life-threatening complications of diabetes mellitus which require prompt treatment with large volume crystalloid fluid administration. A variety of crystalloid fluids is currently available for use and differs in...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6720374/ https://www.ncbi.nlm.nih.gov/pubmed/31481108 http://dx.doi.org/10.1186/s13643-019-1130-5 |
_version_ | 1783448111523299328 |
---|---|
author | Gershkovich, Benjamin English, Shane W. Doyle, Mary-Anne Menon, Kusum McIntyre, Lauralyn |
author_facet | Gershkovich, Benjamin English, Shane W. Doyle, Mary-Anne Menon, Kusum McIntyre, Lauralyn |
author_sort | Gershkovich, Benjamin |
collection | PubMed |
description | BACKGROUND: Diabetic ketoacidosis (DKA) and hyperglycemic hyperosmolar state (HHS) are life-threatening complications of diabetes mellitus which require prompt treatment with large volume crystalloid fluid administration. A variety of crystalloid fluids is currently available for use and differs in their composition and ion concentrations. While there are potential pros and cons for different crystalloid fluids, it remains unknown if any particular fluid confers a clinical outcome benefit over others in the treatment of hyperglycemic emergencies. METHODS: A systematic search of MEDLINE, Embase, and the Cochrane Library of Systematic Reviews will be conducted to identify eligible studies, which will include observational and interventional studies involving adult and pediatric patients admitted to the hospital with either DKA or HHS. The interventions will include intravenous treatment with 0.9% saline versus other buffered (Ringer’s lactate, Hartmann’s, etc.), and non-buffered (0.45% saline) crystalloid fluids. The primary outcome is mortality at the latest follow-up time point. Secondary outcomes will include mortality at specific time points, length of hospital stay, development of acute kidney injury, requirement for renal replacement therapy, altered level of consciousness, and the time to normalization of several serum biochemical parameters. Where appropriate, meta-analyses will be performed for the outcomes and conducted separately for adult and pediatric patient populations. DISCUSSION: DKA and HHS are dangerous complications of diabetes mellitus and account for significant morbidity and mortality. Given the importance of crystalloid fluid administration in the management of these conditions, a systematic synthesis of the existing evidence base will identify potential evidence gaps and may help guide future clinical practice. |
format | Online Article Text |
id | pubmed-6720374 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-67203742019-09-06 Choice of crystalloid fluid in the treatment of hyperglycemic emergencies: a systematic review protocol Gershkovich, Benjamin English, Shane W. Doyle, Mary-Anne Menon, Kusum McIntyre, Lauralyn Syst Rev Protocol BACKGROUND: Diabetic ketoacidosis (DKA) and hyperglycemic hyperosmolar state (HHS) are life-threatening complications of diabetes mellitus which require prompt treatment with large volume crystalloid fluid administration. A variety of crystalloid fluids is currently available for use and differs in their composition and ion concentrations. While there are potential pros and cons for different crystalloid fluids, it remains unknown if any particular fluid confers a clinical outcome benefit over others in the treatment of hyperglycemic emergencies. METHODS: A systematic search of MEDLINE, Embase, and the Cochrane Library of Systematic Reviews will be conducted to identify eligible studies, which will include observational and interventional studies involving adult and pediatric patients admitted to the hospital with either DKA or HHS. The interventions will include intravenous treatment with 0.9% saline versus other buffered (Ringer’s lactate, Hartmann’s, etc.), and non-buffered (0.45% saline) crystalloid fluids. The primary outcome is mortality at the latest follow-up time point. Secondary outcomes will include mortality at specific time points, length of hospital stay, development of acute kidney injury, requirement for renal replacement therapy, altered level of consciousness, and the time to normalization of several serum biochemical parameters. Where appropriate, meta-analyses will be performed for the outcomes and conducted separately for adult and pediatric patient populations. DISCUSSION: DKA and HHS are dangerous complications of diabetes mellitus and account for significant morbidity and mortality. Given the importance of crystalloid fluid administration in the management of these conditions, a systematic synthesis of the existing evidence base will identify potential evidence gaps and may help guide future clinical practice. BioMed Central 2019-09-03 /pmc/articles/PMC6720374/ /pubmed/31481108 http://dx.doi.org/10.1186/s13643-019-1130-5 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Protocol Gershkovich, Benjamin English, Shane W. Doyle, Mary-Anne Menon, Kusum McIntyre, Lauralyn Choice of crystalloid fluid in the treatment of hyperglycemic emergencies: a systematic review protocol |
title | Choice of crystalloid fluid in the treatment of hyperglycemic emergencies: a systematic review protocol |
title_full | Choice of crystalloid fluid in the treatment of hyperglycemic emergencies: a systematic review protocol |
title_fullStr | Choice of crystalloid fluid in the treatment of hyperglycemic emergencies: a systematic review protocol |
title_full_unstemmed | Choice of crystalloid fluid in the treatment of hyperglycemic emergencies: a systematic review protocol |
title_short | Choice of crystalloid fluid in the treatment of hyperglycemic emergencies: a systematic review protocol |
title_sort | choice of crystalloid fluid in the treatment of hyperglycemic emergencies: a systematic review protocol |
topic | Protocol |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6720374/ https://www.ncbi.nlm.nih.gov/pubmed/31481108 http://dx.doi.org/10.1186/s13643-019-1130-5 |
work_keys_str_mv | AT gershkovichbenjamin choiceofcrystalloidfluidinthetreatmentofhyperglycemicemergenciesasystematicreviewprotocol AT englishshanew choiceofcrystalloidfluidinthetreatmentofhyperglycemicemergenciesasystematicreviewprotocol AT doylemaryanne choiceofcrystalloidfluidinthetreatmentofhyperglycemicemergenciesasystematicreviewprotocol AT menonkusum choiceofcrystalloidfluidinthetreatmentofhyperglycemicemergenciesasystematicreviewprotocol AT mcintyrelauralyn choiceofcrystalloidfluidinthetreatmentofhyperglycemicemergenciesasystematicreviewprotocol |