Cargando…
Effect of Season and Factory on Cheese-Making Efficiency in Parmigiano Reggiano Manufacture
The assessment of the efficiency of the cheese-making process (ECMP) is crucial for the profitability of cheese-factories. A simple way to estimate the ECMP is the measure of the estimated cheese-making losses (ECL), expressed by the ratio between the concentration of each constituent in the residua...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6722500/ https://www.ncbi.nlm.nih.gov/pubmed/31382575 http://dx.doi.org/10.3390/foods8080315 |
_version_ | 1783448551668318208 |
---|---|
author | Franceschi, Piero Malacarne, Massimo Formaggioni, Paolo Cipolat-Gotet, Claudio Stocco, Giorgia Summer, Andrea |
author_facet | Franceschi, Piero Malacarne, Massimo Formaggioni, Paolo Cipolat-Gotet, Claudio Stocco, Giorgia Summer, Andrea |
author_sort | Franceschi, Piero |
collection | PubMed |
description | The assessment of the efficiency of the cheese-making process (ECMP) is crucial for the profitability of cheese-factories. A simple way to estimate the ECMP is the measure of the estimated cheese-making losses (ECL), expressed by the ratio between the concentration of each constituent in the residual whey and in the processed milk. The aim of this research was to evaluate the influence of the season and cheese factory on the efficiency of the cheese-making process in Parmigiano Reggiano cheese manufacture. The study followed the production of 288 Parmigiano Reggiano cheese on 12 batches in three commercial cheese factories. For each batch, samples of the processed milk and whey were collected. Protein, casein, and fat ECL resulted in an average of 27.01%, 0.72%, and 16.93%, respectively. Both milk crude protein and casein contents were negatively correlated with protein ECL, r = −0.141 (p ≤ 0.05), and r = −0.223 (p ≤ 0.001), respectively. The same parameters resulted in a negative correlation with casein ECL (p ≤ 0.001) (r = −0.227 and −0.212, respectively). Moreover, fat ECL was correlated with worse milk coagulation properties and negatively correlated with casein content (r = −0.120; p ≤ 0.05). In conclusion, ECLs depend on both milk characteristics and season. |
format | Online Article Text |
id | pubmed-6722500 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-67225002019-09-10 Effect of Season and Factory on Cheese-Making Efficiency in Parmigiano Reggiano Manufacture Franceschi, Piero Malacarne, Massimo Formaggioni, Paolo Cipolat-Gotet, Claudio Stocco, Giorgia Summer, Andrea Foods Article The assessment of the efficiency of the cheese-making process (ECMP) is crucial for the profitability of cheese-factories. A simple way to estimate the ECMP is the measure of the estimated cheese-making losses (ECL), expressed by the ratio between the concentration of each constituent in the residual whey and in the processed milk. The aim of this research was to evaluate the influence of the season and cheese factory on the efficiency of the cheese-making process in Parmigiano Reggiano cheese manufacture. The study followed the production of 288 Parmigiano Reggiano cheese on 12 batches in three commercial cheese factories. For each batch, samples of the processed milk and whey were collected. Protein, casein, and fat ECL resulted in an average of 27.01%, 0.72%, and 16.93%, respectively. Both milk crude protein and casein contents were negatively correlated with protein ECL, r = −0.141 (p ≤ 0.05), and r = −0.223 (p ≤ 0.001), respectively. The same parameters resulted in a negative correlation with casein ECL (p ≤ 0.001) (r = −0.227 and −0.212, respectively). Moreover, fat ECL was correlated with worse milk coagulation properties and negatively correlated with casein content (r = −0.120; p ≤ 0.05). In conclusion, ECLs depend on both milk characteristics and season. MDPI 2019-08-03 /pmc/articles/PMC6722500/ /pubmed/31382575 http://dx.doi.org/10.3390/foods8080315 Text en © 2019 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Franceschi, Piero Malacarne, Massimo Formaggioni, Paolo Cipolat-Gotet, Claudio Stocco, Giorgia Summer, Andrea Effect of Season and Factory on Cheese-Making Efficiency in Parmigiano Reggiano Manufacture |
title | Effect of Season and Factory on Cheese-Making Efficiency in Parmigiano Reggiano Manufacture |
title_full | Effect of Season and Factory on Cheese-Making Efficiency in Parmigiano Reggiano Manufacture |
title_fullStr | Effect of Season and Factory on Cheese-Making Efficiency in Parmigiano Reggiano Manufacture |
title_full_unstemmed | Effect of Season and Factory on Cheese-Making Efficiency in Parmigiano Reggiano Manufacture |
title_short | Effect of Season and Factory on Cheese-Making Efficiency in Parmigiano Reggiano Manufacture |
title_sort | effect of season and factory on cheese-making efficiency in parmigiano reggiano manufacture |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6722500/ https://www.ncbi.nlm.nih.gov/pubmed/31382575 http://dx.doi.org/10.3390/foods8080315 |
work_keys_str_mv | AT franceschipiero effectofseasonandfactoryoncheesemakingefficiencyinparmigianoreggianomanufacture AT malacarnemassimo effectofseasonandfactoryoncheesemakingefficiencyinparmigianoreggianomanufacture AT formaggionipaolo effectofseasonandfactoryoncheesemakingefficiencyinparmigianoreggianomanufacture AT cipolatgotetclaudio effectofseasonandfactoryoncheesemakingefficiencyinparmigianoreggianomanufacture AT stoccogiorgia effectofseasonandfactoryoncheesemakingefficiencyinparmigianoreggianomanufacture AT summerandrea effectofseasonandfactoryoncheesemakingefficiencyinparmigianoreggianomanufacture |