Cargando…
The association between premorbid beta blocker exposure and mortality in sepsis—a systematic review
BACKGROUND: The effect of premorbid β-blocker exposure on clinical outcomes in patients with sepsis is not well characterized. We aimed to examine the association between premorbid β-blocker exposure and mortality in sepsis. METHODS: EMBase, MEDLINE, and Cochrane databases were searched for all stud...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6727531/ https://www.ncbi.nlm.nih.gov/pubmed/31484576 http://dx.doi.org/10.1186/s13054-019-2562-y |
_version_ | 1783449270585655296 |
---|---|
author | Tan, Kaiquan Harazim, Martin Tang, Benjamin Mclean, Anthony Nalos, Marek |
author_facet | Tan, Kaiquan Harazim, Martin Tang, Benjamin Mclean, Anthony Nalos, Marek |
author_sort | Tan, Kaiquan |
collection | PubMed |
description | BACKGROUND: The effect of premorbid β-blocker exposure on clinical outcomes in patients with sepsis is not well characterized. We aimed to examine the association between premorbid β-blocker exposure and mortality in sepsis. METHODS: EMBase, MEDLINE, and Cochrane databases were searched for all studies of premorbid β-blocker and sepsis. The search was last updated on 22 June 2019. Two reviewers independently assessed, selected, and abstracted data from studies reporting chronic β-blocker use prior to sepsis and mortality. Main data extracted were premorbid β-blocker exposure, mortality, study design, and patient data. Two reviewers independently assessed the risk of bias and quality of evidence. RESULTS: In total, nine studies comprising 56,414 patients with sepsis including 6576 patients with premorbid exposure to β-blockers were eligible. For the primary outcome of mortality, two retrospective studies reported adjusted odds ratios showing a reduction in mortality with premorbid β-blocker exposure. One study showed that premorbid β-blocker exposure decreases mortality in patients with septic shock. Another study showed that continued β-blockade during sepsis is associated with decreased mortality. CONCLUSION: This systematic review suggests that β-blocker exposure prior to sepsis is associated with reduced mortality. There was insufficient data to conduct a bona fide meta-analysis. Whether the apparent reduction in mortality may be attributed to the mitigation of catecholamine excess is unclear. TRIAL REGISTRATION: PROSPERO, CRD42019130558 registered June 12, 2019. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13054-019-2562-y) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-6727531 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-67275312019-09-12 The association between premorbid beta blocker exposure and mortality in sepsis—a systematic review Tan, Kaiquan Harazim, Martin Tang, Benjamin Mclean, Anthony Nalos, Marek Crit Care Research BACKGROUND: The effect of premorbid β-blocker exposure on clinical outcomes in patients with sepsis is not well characterized. We aimed to examine the association between premorbid β-blocker exposure and mortality in sepsis. METHODS: EMBase, MEDLINE, and Cochrane databases were searched for all studies of premorbid β-blocker and sepsis. The search was last updated on 22 June 2019. Two reviewers independently assessed, selected, and abstracted data from studies reporting chronic β-blocker use prior to sepsis and mortality. Main data extracted were premorbid β-blocker exposure, mortality, study design, and patient data. Two reviewers independently assessed the risk of bias and quality of evidence. RESULTS: In total, nine studies comprising 56,414 patients with sepsis including 6576 patients with premorbid exposure to β-blockers were eligible. For the primary outcome of mortality, two retrospective studies reported adjusted odds ratios showing a reduction in mortality with premorbid β-blocker exposure. One study showed that premorbid β-blocker exposure decreases mortality in patients with septic shock. Another study showed that continued β-blockade during sepsis is associated with decreased mortality. CONCLUSION: This systematic review suggests that β-blocker exposure prior to sepsis is associated with reduced mortality. There was insufficient data to conduct a bona fide meta-analysis. Whether the apparent reduction in mortality may be attributed to the mitigation of catecholamine excess is unclear. TRIAL REGISTRATION: PROSPERO, CRD42019130558 registered June 12, 2019. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13054-019-2562-y) contains supplementary material, which is available to authorized users. BioMed Central 2019-09-04 /pmc/articles/PMC6727531/ /pubmed/31484576 http://dx.doi.org/10.1186/s13054-019-2562-y Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Tan, Kaiquan Harazim, Martin Tang, Benjamin Mclean, Anthony Nalos, Marek The association between premorbid beta blocker exposure and mortality in sepsis—a systematic review |
title | The association between premorbid beta blocker exposure and mortality in sepsis—a systematic review |
title_full | The association between premorbid beta blocker exposure and mortality in sepsis—a systematic review |
title_fullStr | The association between premorbid beta blocker exposure and mortality in sepsis—a systematic review |
title_full_unstemmed | The association between premorbid beta blocker exposure and mortality in sepsis—a systematic review |
title_short | The association between premorbid beta blocker exposure and mortality in sepsis—a systematic review |
title_sort | association between premorbid beta blocker exposure and mortality in sepsis—a systematic review |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6727531/ https://www.ncbi.nlm.nih.gov/pubmed/31484576 http://dx.doi.org/10.1186/s13054-019-2562-y |
work_keys_str_mv | AT tankaiquan theassociationbetweenpremorbidbetablockerexposureandmortalityinsepsisasystematicreview AT harazimmartin theassociationbetweenpremorbidbetablockerexposureandmortalityinsepsisasystematicreview AT tangbenjamin theassociationbetweenpremorbidbetablockerexposureandmortalityinsepsisasystematicreview AT mcleananthony theassociationbetweenpremorbidbetablockerexposureandmortalityinsepsisasystematicreview AT nalosmarek theassociationbetweenpremorbidbetablockerexposureandmortalityinsepsisasystematicreview AT tankaiquan associationbetweenpremorbidbetablockerexposureandmortalityinsepsisasystematicreview AT harazimmartin associationbetweenpremorbidbetablockerexposureandmortalityinsepsisasystematicreview AT tangbenjamin associationbetweenpremorbidbetablockerexposureandmortalityinsepsisasystematicreview AT mcleananthony associationbetweenpremorbidbetablockerexposureandmortalityinsepsisasystematicreview AT nalosmarek associationbetweenpremorbidbetablockerexposureandmortalityinsepsisasystematicreview |