Cargando…
Clinical, pathophysiologic, and genomic analysis of the outcomes of primary head and neck malignancy after pulmonary metastasectomy
The median overall survival (OS) of some head and neck malignancies, such as head and neck squamous cell carcinoma (HNSCC), with metastatic lesions was only 12 months. Whether aggressive pulmonary metastasectomy (PM) improves survival is controversial. Patients with primary head and neck malignancy...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group UK
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6733860/ https://www.ncbi.nlm.nih.gov/pubmed/31501464 http://dx.doi.org/10.1038/s41598-019-49212-y |
_version_ | 1783450040719638528 |
---|---|
author | Lu, Hsueh-Ju Hsieh, Chih-Cheng Yeh, Chi-Chun Yeh, Yi-Chen Wu, Chun-Chi Wang, Feng-Sheng Lai, Jin-Mei Yang, Muh-Hwa Wang, Cheng-Hsu Huang, Chi-Ying F. Chang, Peter Mu-Hsin |
author_facet | Lu, Hsueh-Ju Hsieh, Chih-Cheng Yeh, Chi-Chun Yeh, Yi-Chen Wu, Chun-Chi Wang, Feng-Sheng Lai, Jin-Mei Yang, Muh-Hwa Wang, Cheng-Hsu Huang, Chi-Ying F. Chang, Peter Mu-Hsin |
author_sort | Lu, Hsueh-Ju |
collection | PubMed |
description | The median overall survival (OS) of some head and neck malignancies, such as head and neck squamous cell carcinoma (HNSCC), with metastatic lesions was only 12 months. Whether aggressive pulmonary metastasectomy (PM) improves survival is controversial. Patients with primary head and neck malignancy undergoing PM were enrolled. Clinical outcomes were compared among different histological types. Whole-exome sequencing was used for matched pulmonary metastatic samples. The genes where genetic variants have been identified were sent for analysis by DAVID, IPA, and STRING. Forty-nine patients with primary head and neck malignancies were enrolled. Two-year postmetastasectomy survival (PMS) rates of adenoid cystic carcinoma, thyroid carcinoma, nasopharyngeal carcinoma, and HNSCC were 100%, 88.2%, 71.4%, and 59.2%, respectively (P = 0.024). In HNSCC, the time to distant metastasis was an independent predictive factor of the efficacy of PM. Several pathways, such as branched-chain amino acid (BCAA) consumption, were significantly associated with the progression of HNSCC [P < 0.001, fold enrichment (FE) = 5.45]. Moreover, metabolism-associated signaling pathways also seemed to be involved in cancer metastasis. Histological types and time to distant metastasis were important factors influencing the clinical outcomes of PM. For HNSCC, metabolic-associated signaling pathways were significantly associated with tumor progression and distant metastasis. Future validations are warranted. |
format | Online Article Text |
id | pubmed-6733860 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Nature Publishing Group UK |
record_format | MEDLINE/PubMed |
spelling | pubmed-67338602019-09-20 Clinical, pathophysiologic, and genomic analysis of the outcomes of primary head and neck malignancy after pulmonary metastasectomy Lu, Hsueh-Ju Hsieh, Chih-Cheng Yeh, Chi-Chun Yeh, Yi-Chen Wu, Chun-Chi Wang, Feng-Sheng Lai, Jin-Mei Yang, Muh-Hwa Wang, Cheng-Hsu Huang, Chi-Ying F. Chang, Peter Mu-Hsin Sci Rep Article The median overall survival (OS) of some head and neck malignancies, such as head and neck squamous cell carcinoma (HNSCC), with metastatic lesions was only 12 months. Whether aggressive pulmonary metastasectomy (PM) improves survival is controversial. Patients with primary head and neck malignancy undergoing PM were enrolled. Clinical outcomes were compared among different histological types. Whole-exome sequencing was used for matched pulmonary metastatic samples. The genes where genetic variants have been identified were sent for analysis by DAVID, IPA, and STRING. Forty-nine patients with primary head and neck malignancies were enrolled. Two-year postmetastasectomy survival (PMS) rates of adenoid cystic carcinoma, thyroid carcinoma, nasopharyngeal carcinoma, and HNSCC were 100%, 88.2%, 71.4%, and 59.2%, respectively (P = 0.024). In HNSCC, the time to distant metastasis was an independent predictive factor of the efficacy of PM. Several pathways, such as branched-chain amino acid (BCAA) consumption, were significantly associated with the progression of HNSCC [P < 0.001, fold enrichment (FE) = 5.45]. Moreover, metabolism-associated signaling pathways also seemed to be involved in cancer metastasis. Histological types and time to distant metastasis were important factors influencing the clinical outcomes of PM. For HNSCC, metabolic-associated signaling pathways were significantly associated with tumor progression and distant metastasis. Future validations are warranted. Nature Publishing Group UK 2019-09-09 /pmc/articles/PMC6733860/ /pubmed/31501464 http://dx.doi.org/10.1038/s41598-019-49212-y Text en © The Author(s) 2019 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/. |
spellingShingle | Article Lu, Hsueh-Ju Hsieh, Chih-Cheng Yeh, Chi-Chun Yeh, Yi-Chen Wu, Chun-Chi Wang, Feng-Sheng Lai, Jin-Mei Yang, Muh-Hwa Wang, Cheng-Hsu Huang, Chi-Ying F. Chang, Peter Mu-Hsin Clinical, pathophysiologic, and genomic analysis of the outcomes of primary head and neck malignancy after pulmonary metastasectomy |
title | Clinical, pathophysiologic, and genomic analysis of the outcomes of primary head and neck malignancy after pulmonary metastasectomy |
title_full | Clinical, pathophysiologic, and genomic analysis of the outcomes of primary head and neck malignancy after pulmonary metastasectomy |
title_fullStr | Clinical, pathophysiologic, and genomic analysis of the outcomes of primary head and neck malignancy after pulmonary metastasectomy |
title_full_unstemmed | Clinical, pathophysiologic, and genomic analysis of the outcomes of primary head and neck malignancy after pulmonary metastasectomy |
title_short | Clinical, pathophysiologic, and genomic analysis of the outcomes of primary head and neck malignancy after pulmonary metastasectomy |
title_sort | clinical, pathophysiologic, and genomic analysis of the outcomes of primary head and neck malignancy after pulmonary metastasectomy |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6733860/ https://www.ncbi.nlm.nih.gov/pubmed/31501464 http://dx.doi.org/10.1038/s41598-019-49212-y |
work_keys_str_mv | AT luhsuehju clinicalpathophysiologicandgenomicanalysisoftheoutcomesofprimaryheadandneckmalignancyafterpulmonarymetastasectomy AT hsiehchihcheng clinicalpathophysiologicandgenomicanalysisoftheoutcomesofprimaryheadandneckmalignancyafterpulmonarymetastasectomy AT yehchichun clinicalpathophysiologicandgenomicanalysisoftheoutcomesofprimaryheadandneckmalignancyafterpulmonarymetastasectomy AT yehyichen clinicalpathophysiologicandgenomicanalysisoftheoutcomesofprimaryheadandneckmalignancyafterpulmonarymetastasectomy AT wuchunchi clinicalpathophysiologicandgenomicanalysisoftheoutcomesofprimaryheadandneckmalignancyafterpulmonarymetastasectomy AT wangfengsheng clinicalpathophysiologicandgenomicanalysisoftheoutcomesofprimaryheadandneckmalignancyafterpulmonarymetastasectomy AT laijinmei clinicalpathophysiologicandgenomicanalysisoftheoutcomesofprimaryheadandneckmalignancyafterpulmonarymetastasectomy AT yangmuhhwa clinicalpathophysiologicandgenomicanalysisoftheoutcomesofprimaryheadandneckmalignancyafterpulmonarymetastasectomy AT wangchenghsu clinicalpathophysiologicandgenomicanalysisoftheoutcomesofprimaryheadandneckmalignancyafterpulmonarymetastasectomy AT huangchiyingf clinicalpathophysiologicandgenomicanalysisoftheoutcomesofprimaryheadandneckmalignancyafterpulmonarymetastasectomy AT changpetermuhsin clinicalpathophysiologicandgenomicanalysisoftheoutcomesofprimaryheadandneckmalignancyafterpulmonarymetastasectomy |