Cargando…
Long-Lived Plasma Cells Secrete High-Affinity Antibodies Responding to a T-Dependent Immunization in a Teleost Fish
The recent discovery of long-lived plasma cells (LLPCs) in mammals, which provide a constant expression of specific high-affinity antibodies that mediate humoral memory, has caused a dramatic paradigm shift in the study of immunity and vaccine development. In teleost fish, there are few studies rega...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6783517/ https://www.ncbi.nlm.nih.gov/pubmed/31632403 http://dx.doi.org/10.3389/fimmu.2019.02324 |
_version_ | 1783457571619733504 |
---|---|
author | Wu, Liting Fu, Shengli Yin, Xiaoxue Guo, Zheng Wang, Anli Ye, Jianmin |
author_facet | Wu, Liting Fu, Shengli Yin, Xiaoxue Guo, Zheng Wang, Anli Ye, Jianmin |
author_sort | Wu, Liting |
collection | PubMed |
description | The recent discovery of long-lived plasma cells (LLPCs) in mammals, which provide a constant expression of specific high-affinity antibodies that mediate humoral memory, has caused a dramatic paradigm shift in the study of immunity and vaccine development. In teleost fish, there are few studies regarding the association between LLPCs and antibody production, and the affinity of the antibodies secreted by the LLPCs is poorly understood. In the present study, channel catfish (Ictalurus punctatus) were immunized with trinitrophenylated-keyhole limpet hemocyanin (TNP-KLH) to examine TNP-specific antibody titers, affinities, antibody-secreting cell (ASC) dynamic changes, and especially the affinity of secreted antibodies by LLPCs post-immunization. We demonstrated that TNP-specific LLPCs were generated starting at week 4 post-immunization, achieved a maximal number at week 8, and maintained a comparable level throughout the 18-week post-immunization period, which was correlated with the dynamics of serum antibody titers and affinity maturation in the response. The LLPCs appeared to mostly reside within, or migrate to, the anterior kidney (bone marrow-like tissue in mammals), but a small portion was also located in the spleen and peripheral blood. The antibodies produced by the LLPCs possessed high affinities, indicating that the generation and development of LLPCs were driven by affinity selection in teleosts. Collectively, the results of this study provide insights toward the evolutionary understanding of the affinity-dependent mechanism of LLPC generation and development. |
format | Online Article Text |
id | pubmed-6783517 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-67835172019-10-18 Long-Lived Plasma Cells Secrete High-Affinity Antibodies Responding to a T-Dependent Immunization in a Teleost Fish Wu, Liting Fu, Shengli Yin, Xiaoxue Guo, Zheng Wang, Anli Ye, Jianmin Front Immunol Immunology The recent discovery of long-lived plasma cells (LLPCs) in mammals, which provide a constant expression of specific high-affinity antibodies that mediate humoral memory, has caused a dramatic paradigm shift in the study of immunity and vaccine development. In teleost fish, there are few studies regarding the association between LLPCs and antibody production, and the affinity of the antibodies secreted by the LLPCs is poorly understood. In the present study, channel catfish (Ictalurus punctatus) were immunized with trinitrophenylated-keyhole limpet hemocyanin (TNP-KLH) to examine TNP-specific antibody titers, affinities, antibody-secreting cell (ASC) dynamic changes, and especially the affinity of secreted antibodies by LLPCs post-immunization. We demonstrated that TNP-specific LLPCs were generated starting at week 4 post-immunization, achieved a maximal number at week 8, and maintained a comparable level throughout the 18-week post-immunization period, which was correlated with the dynamics of serum antibody titers and affinity maturation in the response. The LLPCs appeared to mostly reside within, or migrate to, the anterior kidney (bone marrow-like tissue in mammals), but a small portion was also located in the spleen and peripheral blood. The antibodies produced by the LLPCs possessed high affinities, indicating that the generation and development of LLPCs were driven by affinity selection in teleosts. Collectively, the results of this study provide insights toward the evolutionary understanding of the affinity-dependent mechanism of LLPC generation and development. Frontiers Media S.A. 2019-10-02 /pmc/articles/PMC6783517/ /pubmed/31632403 http://dx.doi.org/10.3389/fimmu.2019.02324 Text en Copyright © 2019 Wu, Fu, Yin, Guo, Wang and Ye. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Immunology Wu, Liting Fu, Shengli Yin, Xiaoxue Guo, Zheng Wang, Anli Ye, Jianmin Long-Lived Plasma Cells Secrete High-Affinity Antibodies Responding to a T-Dependent Immunization in a Teleost Fish |
title | Long-Lived Plasma Cells Secrete High-Affinity Antibodies Responding to a T-Dependent Immunization in a Teleost Fish |
title_full | Long-Lived Plasma Cells Secrete High-Affinity Antibodies Responding to a T-Dependent Immunization in a Teleost Fish |
title_fullStr | Long-Lived Plasma Cells Secrete High-Affinity Antibodies Responding to a T-Dependent Immunization in a Teleost Fish |
title_full_unstemmed | Long-Lived Plasma Cells Secrete High-Affinity Antibodies Responding to a T-Dependent Immunization in a Teleost Fish |
title_short | Long-Lived Plasma Cells Secrete High-Affinity Antibodies Responding to a T-Dependent Immunization in a Teleost Fish |
title_sort | long-lived plasma cells secrete high-affinity antibodies responding to a t-dependent immunization in a teleost fish |
topic | Immunology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6783517/ https://www.ncbi.nlm.nih.gov/pubmed/31632403 http://dx.doi.org/10.3389/fimmu.2019.02324 |
work_keys_str_mv | AT wuliting longlivedplasmacellssecretehighaffinityantibodiesrespondingtoatdependentimmunizationinateleostfish AT fushengli longlivedplasmacellssecretehighaffinityantibodiesrespondingtoatdependentimmunizationinateleostfish AT yinxiaoxue longlivedplasmacellssecretehighaffinityantibodiesrespondingtoatdependentimmunizationinateleostfish AT guozheng longlivedplasmacellssecretehighaffinityantibodiesrespondingtoatdependentimmunizationinateleostfish AT wanganli longlivedplasmacellssecretehighaffinityantibodiesrespondingtoatdependentimmunizationinateleostfish AT yejianmin longlivedplasmacellssecretehighaffinityantibodiesrespondingtoatdependentimmunizationinateleostfish |