Cargando…
Pathogenic variants of PROC gene caused type I activity deficiency in a familial Chinese venous thrombosis
Pathogenic mutation of protein C (PROC) gene results into the deficiency of PROC activity. This study aimed to identify the pathogenic genetic variants and to explore the functional consequence in Chinese familial venous thrombosis (VTE). Whole exome sequencing was performed to identify the pathogen...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
John Wiley and Sons Inc.
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6787509/ https://www.ncbi.nlm.nih.gov/pubmed/31338992 http://dx.doi.org/10.1111/jcmm.14563 |
_version_ | 1783458278927237120 |
---|---|
author | Yue, Yongjian Liu, Shengguo Han, Xuemei Xiao, Lu Huang, Qijun Li, Shulin Zhuang, Kaixue Yang, Mo Zou, Chang Fu, Yingyun |
author_facet | Yue, Yongjian Liu, Shengguo Han, Xuemei Xiao, Lu Huang, Qijun Li, Shulin Zhuang, Kaixue Yang, Mo Zou, Chang Fu, Yingyun |
author_sort | Yue, Yongjian |
collection | PubMed |
description | Pathogenic mutation of protein C (PROC) gene results into the deficiency of PROC activity. This study aimed to identify the pathogenic genetic variants and to explore the functional consequence in Chinese familial venous thrombosis (VTE). Whole exome sequencing was performed to identify the pathogenic variants of anticoagulant factors. Serum coagulation and anti‐coagulation factors activity were assayed to evaluate the genetic association. Functional study of PROC antigen secretion deficiency was conducted in VTE subjects and in vitro cell lines. One rare pathogenic variant (p.Ala178Pro) was identified in the four VTE subjects but not in the normal subjects from the family. An inframeshift variant (rs199469469) was also identified in a paediatric subject of the pedigree. Further evaluation of serum PROC activity levels in p.Ala178Pro variants VTE carriers showed significantly lower PROC activity compared to non‐carriers. Furthermore, in vitro study showed that the p.Ala178Pro mutant cells had a consistent reduction in concentration of PROC antigen. In conclusions, our study demonstrated the pathogenic variant (p.Ala178Pro) contributed to PROC type I activity deficiency, which may be due to decreased secretion of PROC. |
format | Online Article Text |
id | pubmed-6787509 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | John Wiley and Sons Inc. |
record_format | MEDLINE/PubMed |
spelling | pubmed-67875092019-10-17 Pathogenic variants of PROC gene caused type I activity deficiency in a familial Chinese venous thrombosis Yue, Yongjian Liu, Shengguo Han, Xuemei Xiao, Lu Huang, Qijun Li, Shulin Zhuang, Kaixue Yang, Mo Zou, Chang Fu, Yingyun J Cell Mol Med Short Communications Pathogenic mutation of protein C (PROC) gene results into the deficiency of PROC activity. This study aimed to identify the pathogenic genetic variants and to explore the functional consequence in Chinese familial venous thrombosis (VTE). Whole exome sequencing was performed to identify the pathogenic variants of anticoagulant factors. Serum coagulation and anti‐coagulation factors activity were assayed to evaluate the genetic association. Functional study of PROC antigen secretion deficiency was conducted in VTE subjects and in vitro cell lines. One rare pathogenic variant (p.Ala178Pro) was identified in the four VTE subjects but not in the normal subjects from the family. An inframeshift variant (rs199469469) was also identified in a paediatric subject of the pedigree. Further evaluation of serum PROC activity levels in p.Ala178Pro variants VTE carriers showed significantly lower PROC activity compared to non‐carriers. Furthermore, in vitro study showed that the p.Ala178Pro mutant cells had a consistent reduction in concentration of PROC antigen. In conclusions, our study demonstrated the pathogenic variant (p.Ala178Pro) contributed to PROC type I activity deficiency, which may be due to decreased secretion of PROC. John Wiley and Sons Inc. 2019-07-23 2019-10 /pmc/articles/PMC6787509/ /pubmed/31338992 http://dx.doi.org/10.1111/jcmm.14563 Text en © 2019 The Authors. Journal of Cellular and Molecular Medicine published by John Wiley & Sons Ltd and Foundation for Cellular and Molecular Medicine. This is an open access article under the terms of the http://creativecommons.org/licenses/by/4.0/ License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Short Communications Yue, Yongjian Liu, Shengguo Han, Xuemei Xiao, Lu Huang, Qijun Li, Shulin Zhuang, Kaixue Yang, Mo Zou, Chang Fu, Yingyun Pathogenic variants of PROC gene caused type I activity deficiency in a familial Chinese venous thrombosis |
title | Pathogenic variants of PROC gene caused type I activity deficiency in a familial Chinese venous thrombosis |
title_full | Pathogenic variants of PROC gene caused type I activity deficiency in a familial Chinese venous thrombosis |
title_fullStr | Pathogenic variants of PROC gene caused type I activity deficiency in a familial Chinese venous thrombosis |
title_full_unstemmed | Pathogenic variants of PROC gene caused type I activity deficiency in a familial Chinese venous thrombosis |
title_short | Pathogenic variants of PROC gene caused type I activity deficiency in a familial Chinese venous thrombosis |
title_sort | pathogenic variants of proc gene caused type i activity deficiency in a familial chinese venous thrombosis |
topic | Short Communications |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6787509/ https://www.ncbi.nlm.nih.gov/pubmed/31338992 http://dx.doi.org/10.1111/jcmm.14563 |
work_keys_str_mv | AT yueyongjian pathogenicvariantsofprocgenecausedtypeiactivitydeficiencyinafamilialchinesevenousthrombosis AT liushengguo pathogenicvariantsofprocgenecausedtypeiactivitydeficiencyinafamilialchinesevenousthrombosis AT hanxuemei pathogenicvariantsofprocgenecausedtypeiactivitydeficiencyinafamilialchinesevenousthrombosis AT xiaolu pathogenicvariantsofprocgenecausedtypeiactivitydeficiencyinafamilialchinesevenousthrombosis AT huangqijun pathogenicvariantsofprocgenecausedtypeiactivitydeficiencyinafamilialchinesevenousthrombosis AT lishulin pathogenicvariantsofprocgenecausedtypeiactivitydeficiencyinafamilialchinesevenousthrombosis AT zhuangkaixue pathogenicvariantsofprocgenecausedtypeiactivitydeficiencyinafamilialchinesevenousthrombosis AT yangmo pathogenicvariantsofprocgenecausedtypeiactivitydeficiencyinafamilialchinesevenousthrombosis AT zouchang pathogenicvariantsofprocgenecausedtypeiactivitydeficiencyinafamilialchinesevenousthrombosis AT fuyingyun pathogenicvariantsofprocgenecausedtypeiactivitydeficiencyinafamilialchinesevenousthrombosis |