Cargando…

Factors influencing adherence to antiretroviral treatment among adults accessing care from private health facilities in Malawi

BACKGROUND: Private health facilities are increasingly being recognized as the neglected partner in the provision of HIV services. The non-adherence rate in the study sites ranged from 19 to 22%. This study explored the factors associated with non-adherence from antiretroviral therapy (ART) among ad...

Descripción completa

Detalles Bibliográficos
Autores principales: Chirambo, Lusungu, Valeta, Martha, Banda Kamanga, Tifiness Mary, Nyondo-Mipando, Alinane Linda
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6816213/
https://www.ncbi.nlm.nih.gov/pubmed/31660947
http://dx.doi.org/10.1186/s12889-019-7768-z
_version_ 1783463341141786624
author Chirambo, Lusungu
Valeta, Martha
Banda Kamanga, Tifiness Mary
Nyondo-Mipando, Alinane Linda
author_facet Chirambo, Lusungu
Valeta, Martha
Banda Kamanga, Tifiness Mary
Nyondo-Mipando, Alinane Linda
author_sort Chirambo, Lusungu
collection PubMed
description BACKGROUND: Private health facilities are increasingly being recognized as the neglected partner in the provision of HIV services. The non-adherence rate in the study sites ranged from 19 to 22%. This study explored the factors associated with non-adherence from antiretroviral therapy (ART) among adult patients accessing ART services at two privately owned urban health facilities in Malawi. METHODS: We conducted a descriptive qualitative approach employing in-depth interviews among adults who either defaulted or were retained in HIV care in two privately owned facilities in Malawi from March to July 2017. We purposively selected participants and interviewed a total of 6 ART providers and 24 ART clients. Data were analyzed manually using a thematic approach. RESULTS: Overall, participants identified four facilitators for retention in care and four broad categories of barriers namely individual, psychological, drug related and human resource related factors. The factors that facilitated retention in care included follow up visits after missing a visit, adequate information education and counseling, and supportive relationships. CONCLUSION: The main reason for defaulting from antiretrovirals (ARVs) was fear of disclosing an HIV status to avert potential stigma and discrimination. In implementing ART clinics due consideration and strategies need to be adopted to ensure that privacy and confidentiality is preserved. Although adoption of all the key Malawi Implementing strategies like expert clients and a guardian may optimize retention in care, there is need for prior analysis of how those may lead to unintended disclosure which inadvertently affects adherence. Furthermore, private facilities should orient their clients to the public facilities within the catchment area so that clients have an option for alternative access to HIV care in the event of financial constraints.
format Online
Article
Text
id pubmed-6816213
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-68162132019-10-31 Factors influencing adherence to antiretroviral treatment among adults accessing care from private health facilities in Malawi Chirambo, Lusungu Valeta, Martha Banda Kamanga, Tifiness Mary Nyondo-Mipando, Alinane Linda BMC Public Health Research Article BACKGROUND: Private health facilities are increasingly being recognized as the neglected partner in the provision of HIV services. The non-adherence rate in the study sites ranged from 19 to 22%. This study explored the factors associated with non-adherence from antiretroviral therapy (ART) among adult patients accessing ART services at two privately owned urban health facilities in Malawi. METHODS: We conducted a descriptive qualitative approach employing in-depth interviews among adults who either defaulted or were retained in HIV care in two privately owned facilities in Malawi from March to July 2017. We purposively selected participants and interviewed a total of 6 ART providers and 24 ART clients. Data were analyzed manually using a thematic approach. RESULTS: Overall, participants identified four facilitators for retention in care and four broad categories of barriers namely individual, psychological, drug related and human resource related factors. The factors that facilitated retention in care included follow up visits after missing a visit, adequate information education and counseling, and supportive relationships. CONCLUSION: The main reason for defaulting from antiretrovirals (ARVs) was fear of disclosing an HIV status to avert potential stigma and discrimination. In implementing ART clinics due consideration and strategies need to be adopted to ensure that privacy and confidentiality is preserved. Although adoption of all the key Malawi Implementing strategies like expert clients and a guardian may optimize retention in care, there is need for prior analysis of how those may lead to unintended disclosure which inadvertently affects adherence. Furthermore, private facilities should orient their clients to the public facilities within the catchment area so that clients have an option for alternative access to HIV care in the event of financial constraints. BioMed Central 2019-10-28 /pmc/articles/PMC6816213/ /pubmed/31660947 http://dx.doi.org/10.1186/s12889-019-7768-z Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Chirambo, Lusungu
Valeta, Martha
Banda Kamanga, Tifiness Mary
Nyondo-Mipando, Alinane Linda
Factors influencing adherence to antiretroviral treatment among adults accessing care from private health facilities in Malawi
title Factors influencing adherence to antiretroviral treatment among adults accessing care from private health facilities in Malawi
title_full Factors influencing adherence to antiretroviral treatment among adults accessing care from private health facilities in Malawi
title_fullStr Factors influencing adherence to antiretroviral treatment among adults accessing care from private health facilities in Malawi
title_full_unstemmed Factors influencing adherence to antiretroviral treatment among adults accessing care from private health facilities in Malawi
title_short Factors influencing adherence to antiretroviral treatment among adults accessing care from private health facilities in Malawi
title_sort factors influencing adherence to antiretroviral treatment among adults accessing care from private health facilities in malawi
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6816213/
https://www.ncbi.nlm.nih.gov/pubmed/31660947
http://dx.doi.org/10.1186/s12889-019-7768-z
work_keys_str_mv AT chirambolusungu factorsinfluencingadherencetoantiretroviraltreatmentamongadultsaccessingcarefromprivatehealthfacilitiesinmalawi
AT valetamartha factorsinfluencingadherencetoantiretroviraltreatmentamongadultsaccessingcarefromprivatehealthfacilitiesinmalawi
AT bandakamangatifinessmary factorsinfluencingadherencetoantiretroviraltreatmentamongadultsaccessingcarefromprivatehealthfacilitiesinmalawi
AT nyondomipandoalinanelinda factorsinfluencingadherencetoantiretroviraltreatmentamongadultsaccessingcarefromprivatehealthfacilitiesinmalawi