Cargando…

A complete mitochondrial DNA genome of whitefly species (Hemiptera: Aleyrodidae) from Litchi chinensis

A novel complete mitochondrial genome (mitogenome) of whitefly species, collected from Litchi chinensis at Fujian province of China (hereafter whitefly_Litchi chinensis _China) (GenBank accession number: MH999477), was described in this study. The mitogenome of whitefly_Litchi chinensis _China is 15...

Descripción completa

Detalles Bibliográficos
Autores principales: Wang, Hua-Ling, Lei, Teng, Liu, Yin-Quan
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Taylor & Francis 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6816494/
https://www.ncbi.nlm.nih.gov/pubmed/31709305
http://dx.doi.org/10.1080/23802359.2018.1551076
_version_ 1783463377348067328
author Wang, Hua-Ling
Lei, Teng
Liu, Yin-Quan
author_facet Wang, Hua-Ling
Lei, Teng
Liu, Yin-Quan
author_sort Wang, Hua-Ling
collection PubMed
description A novel complete mitochondrial genome (mitogenome) of whitefly species, collected from Litchi chinensis at Fujian province of China (hereafter whitefly_Litchi chinensis _China) (GenBank accession number: MH999477), was described in this study. The mitogenome of whitefly_Litchi chinensis _China is 15,360 bp in length and contains 13 protein-coding genes, 21 transfer RNAs, 2 ribosomal RNAs and a non-coding AT-rich region (D-loop). The arrangement of mitochondrial genes of whitefly_Litchi chinensis_China are identical with Aleurochiton aceris, but remarkably different from the mitogenomes of the other whitefly genus. Most protein-coding genes (PCGs) start with ATN, except for nad2, cox2 and atp6 genes starting with TTG, GTG, and TTG, respectively; 10 of the 13 PCGs use the typical stop codon TAN, whereas cox1, and cox2 stop with a single T. Phylogenetic analyses based on 13 PCGs support the close relationship of the sample with Aleurochiton aceris, which would provide us further insights on the taxonomy and phylogeny of Aleyrodidae.
format Online
Article
Text
id pubmed-6816494
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Taylor & Francis
record_format MEDLINE/PubMed
spelling pubmed-68164942019-11-07 A complete mitochondrial DNA genome of whitefly species (Hemiptera: Aleyrodidae) from Litchi chinensis Wang, Hua-Ling Lei, Teng Liu, Yin-Quan Mitochondrial DNA B Resour Mitogenome Announcement A novel complete mitochondrial genome (mitogenome) of whitefly species, collected from Litchi chinensis at Fujian province of China (hereafter whitefly_Litchi chinensis _China) (GenBank accession number: MH999477), was described in this study. The mitogenome of whitefly_Litchi chinensis _China is 15,360 bp in length and contains 13 protein-coding genes, 21 transfer RNAs, 2 ribosomal RNAs and a non-coding AT-rich region (D-loop). The arrangement of mitochondrial genes of whitefly_Litchi chinensis_China are identical with Aleurochiton aceris, but remarkably different from the mitogenomes of the other whitefly genus. Most protein-coding genes (PCGs) start with ATN, except for nad2, cox2 and atp6 genes starting with TTG, GTG, and TTG, respectively; 10 of the 13 PCGs use the typical stop codon TAN, whereas cox1, and cox2 stop with a single T. Phylogenetic analyses based on 13 PCGs support the close relationship of the sample with Aleurochiton aceris, which would provide us further insights on the taxonomy and phylogeny of Aleyrodidae. Taylor & Francis 2019-07-26 /pmc/articles/PMC6816494/ /pubmed/31709305 http://dx.doi.org/10.1080/23802359.2018.1551076 Text en © 2019 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. http://creativecommons.org/licenses/by/4.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.http://creativecommons.org/licenses/by/4.0/
spellingShingle Mitogenome Announcement
Wang, Hua-Ling
Lei, Teng
Liu, Yin-Quan
A complete mitochondrial DNA genome of whitefly species (Hemiptera: Aleyrodidae) from Litchi chinensis
title A complete mitochondrial DNA genome of whitefly species (Hemiptera: Aleyrodidae) from Litchi chinensis
title_full A complete mitochondrial DNA genome of whitefly species (Hemiptera: Aleyrodidae) from Litchi chinensis
title_fullStr A complete mitochondrial DNA genome of whitefly species (Hemiptera: Aleyrodidae) from Litchi chinensis
title_full_unstemmed A complete mitochondrial DNA genome of whitefly species (Hemiptera: Aleyrodidae) from Litchi chinensis
title_short A complete mitochondrial DNA genome of whitefly species (Hemiptera: Aleyrodidae) from Litchi chinensis
title_sort complete mitochondrial dna genome of whitefly species (hemiptera: aleyrodidae) from litchi chinensis
topic Mitogenome Announcement
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6816494/
https://www.ncbi.nlm.nih.gov/pubmed/31709305
http://dx.doi.org/10.1080/23802359.2018.1551076
work_keys_str_mv AT wanghualing acompletemitochondrialdnagenomeofwhiteflyspecieshemipteraaleyrodidaefromlitchichinensis
AT leiteng acompletemitochondrialdnagenomeofwhiteflyspecieshemipteraaleyrodidaefromlitchichinensis
AT liuyinquan acompletemitochondrialdnagenomeofwhiteflyspecieshemipteraaleyrodidaefromlitchichinensis
AT wanghualing completemitochondrialdnagenomeofwhiteflyspecieshemipteraaleyrodidaefromlitchichinensis
AT leiteng completemitochondrialdnagenomeofwhiteflyspecieshemipteraaleyrodidaefromlitchichinensis
AT liuyinquan completemitochondrialdnagenomeofwhiteflyspecieshemipteraaleyrodidaefromlitchichinensis