Cargando…
A complete mitochondrial DNA genome of whitefly species (Hemiptera: Aleyrodidae) from Litchi chinensis
A novel complete mitochondrial genome (mitogenome) of whitefly species, collected from Litchi chinensis at Fujian province of China (hereafter whitefly_Litchi chinensis _China) (GenBank accession number: MH999477), was described in this study. The mitogenome of whitefly_Litchi chinensis _China is 15...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Taylor & Francis
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6816494/ https://www.ncbi.nlm.nih.gov/pubmed/31709305 http://dx.doi.org/10.1080/23802359.2018.1551076 |
_version_ | 1783463377348067328 |
---|---|
author | Wang, Hua-Ling Lei, Teng Liu, Yin-Quan |
author_facet | Wang, Hua-Ling Lei, Teng Liu, Yin-Quan |
author_sort | Wang, Hua-Ling |
collection | PubMed |
description | A novel complete mitochondrial genome (mitogenome) of whitefly species, collected from Litchi chinensis at Fujian province of China (hereafter whitefly_Litchi chinensis _China) (GenBank accession number: MH999477), was described in this study. The mitogenome of whitefly_Litchi chinensis _China is 15,360 bp in length and contains 13 protein-coding genes, 21 transfer RNAs, 2 ribosomal RNAs and a non-coding AT-rich region (D-loop). The arrangement of mitochondrial genes of whitefly_Litchi chinensis_China are identical with Aleurochiton aceris, but remarkably different from the mitogenomes of the other whitefly genus. Most protein-coding genes (PCGs) start with ATN, except for nad2, cox2 and atp6 genes starting with TTG, GTG, and TTG, respectively; 10 of the 13 PCGs use the typical stop codon TAN, whereas cox1, and cox2 stop with a single T. Phylogenetic analyses based on 13 PCGs support the close relationship of the sample with Aleurochiton aceris, which would provide us further insights on the taxonomy and phylogeny of Aleyrodidae. |
format | Online Article Text |
id | pubmed-6816494 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Taylor & Francis |
record_format | MEDLINE/PubMed |
spelling | pubmed-68164942019-11-07 A complete mitochondrial DNA genome of whitefly species (Hemiptera: Aleyrodidae) from Litchi chinensis Wang, Hua-Ling Lei, Teng Liu, Yin-Quan Mitochondrial DNA B Resour Mitogenome Announcement A novel complete mitochondrial genome (mitogenome) of whitefly species, collected from Litchi chinensis at Fujian province of China (hereafter whitefly_Litchi chinensis _China) (GenBank accession number: MH999477), was described in this study. The mitogenome of whitefly_Litchi chinensis _China is 15,360 bp in length and contains 13 protein-coding genes, 21 transfer RNAs, 2 ribosomal RNAs and a non-coding AT-rich region (D-loop). The arrangement of mitochondrial genes of whitefly_Litchi chinensis_China are identical with Aleurochiton aceris, but remarkably different from the mitogenomes of the other whitefly genus. Most protein-coding genes (PCGs) start with ATN, except for nad2, cox2 and atp6 genes starting with TTG, GTG, and TTG, respectively; 10 of the 13 PCGs use the typical stop codon TAN, whereas cox1, and cox2 stop with a single T. Phylogenetic analyses based on 13 PCGs support the close relationship of the sample with Aleurochiton aceris, which would provide us further insights on the taxonomy and phylogeny of Aleyrodidae. Taylor & Francis 2019-07-26 /pmc/articles/PMC6816494/ /pubmed/31709305 http://dx.doi.org/10.1080/23802359.2018.1551076 Text en © 2019 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. http://creativecommons.org/licenses/by/4.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.http://creativecommons.org/licenses/by/4.0/ |
spellingShingle | Mitogenome Announcement Wang, Hua-Ling Lei, Teng Liu, Yin-Quan A complete mitochondrial DNA genome of whitefly species (Hemiptera: Aleyrodidae) from Litchi chinensis |
title | A complete mitochondrial DNA genome of whitefly species (Hemiptera: Aleyrodidae) from Litchi chinensis |
title_full | A complete mitochondrial DNA genome of whitefly species (Hemiptera: Aleyrodidae) from Litchi chinensis |
title_fullStr | A complete mitochondrial DNA genome of whitefly species (Hemiptera: Aleyrodidae) from Litchi chinensis |
title_full_unstemmed | A complete mitochondrial DNA genome of whitefly species (Hemiptera: Aleyrodidae) from Litchi chinensis |
title_short | A complete mitochondrial DNA genome of whitefly species (Hemiptera: Aleyrodidae) from Litchi chinensis |
title_sort | complete mitochondrial dna genome of whitefly species (hemiptera: aleyrodidae) from litchi chinensis |
topic | Mitogenome Announcement |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6816494/ https://www.ncbi.nlm.nih.gov/pubmed/31709305 http://dx.doi.org/10.1080/23802359.2018.1551076 |
work_keys_str_mv | AT wanghualing acompletemitochondrialdnagenomeofwhiteflyspecieshemipteraaleyrodidaefromlitchichinensis AT leiteng acompletemitochondrialdnagenomeofwhiteflyspecieshemipteraaleyrodidaefromlitchichinensis AT liuyinquan acompletemitochondrialdnagenomeofwhiteflyspecieshemipteraaleyrodidaefromlitchichinensis AT wanghualing completemitochondrialdnagenomeofwhiteflyspecieshemipteraaleyrodidaefromlitchichinensis AT leiteng completemitochondrialdnagenomeofwhiteflyspecieshemipteraaleyrodidaefromlitchichinensis AT liuyinquan completemitochondrialdnagenomeofwhiteflyspecieshemipteraaleyrodidaefromlitchichinensis |