Cargando…
Wild-type menin is rapidly degraded via the ubiquitin-proteasome pathway in a rat insulinoma cell line
Menin is encoded by multiple endocrine neoplasia type 1 (MEN1) gene, the germ line mutations of which are the main cause of pancreatic neuroendocrine tumors (PNETs). To date, a large number of frameshift, nonsense and missense mutations of MEN1 have been identified to be responsible for part of MEN1...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Portland Press Ltd.
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6822493/ https://www.ncbi.nlm.nih.gov/pubmed/31652443 http://dx.doi.org/10.1042/BSR20190471 |
_version_ | 1783464349708320768 |
---|---|
author | Jiang, Zongzhe Wan, Shengrong Xing, Bowen |
author_facet | Jiang, Zongzhe Wan, Shengrong Xing, Bowen |
author_sort | Jiang, Zongzhe |
collection | PubMed |
description | Menin is encoded by multiple endocrine neoplasia type 1 (MEN1) gene, the germ line mutations of which are the main cause of pancreatic neuroendocrine tumors (PNETs). To date, a large number of frameshift, nonsense and missense mutations of MEN1 have been identified to be responsible for part of MEN1-defficient PNETs patients due to truncation or rapid degradation of menin protein. However, the stability of the wild-type (WT) menin in PNETs is totally unknown. In the present study, we observed ubiquitination of WT menin in 293T cells by transfection of ectopic WT menin and HA-ubiquitin. As expected, either endogenous or ectopic WT menin is stable in 293T cells, whereas in INS-1 cells, a rat insulinoma cell line derived from PNETs, either endogenous or ectopic WT menin is rapidly degraded through ubiquitin-proteasome pathway. Furthermore, the degradation of WT menin is more rapid in the presence of serum. Our findings suggest that in part of PNETs patients with WT MEN1, a ubiquitin-proteasome system targeting menin is untimely activated. |
format | Online Article Text |
id | pubmed-6822493 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Portland Press Ltd. |
record_format | MEDLINE/PubMed |
spelling | pubmed-68224932019-11-06 Wild-type menin is rapidly degraded via the ubiquitin-proteasome pathway in a rat insulinoma cell line Jiang, Zongzhe Wan, Shengrong Xing, Bowen Biosci Rep Chemical Biology Menin is encoded by multiple endocrine neoplasia type 1 (MEN1) gene, the germ line mutations of which are the main cause of pancreatic neuroendocrine tumors (PNETs). To date, a large number of frameshift, nonsense and missense mutations of MEN1 have been identified to be responsible for part of MEN1-defficient PNETs patients due to truncation or rapid degradation of menin protein. However, the stability of the wild-type (WT) menin in PNETs is totally unknown. In the present study, we observed ubiquitination of WT menin in 293T cells by transfection of ectopic WT menin and HA-ubiquitin. As expected, either endogenous or ectopic WT menin is stable in 293T cells, whereas in INS-1 cells, a rat insulinoma cell line derived from PNETs, either endogenous or ectopic WT menin is rapidly degraded through ubiquitin-proteasome pathway. Furthermore, the degradation of WT menin is more rapid in the presence of serum. Our findings suggest that in part of PNETs patients with WT MEN1, a ubiquitin-proteasome system targeting menin is untimely activated. Portland Press Ltd. 2019-10-18 /pmc/articles/PMC6822493/ /pubmed/31652443 http://dx.doi.org/10.1042/BSR20190471 Text en © 2019 The Author(s). https://creativecommons.org/licenses/by/4.0/ This is an open access article published by Portland Press Limited on behalf of the Biochemical Society and distributed under the Creative Commons Attribution License 4.0 (CC BY). |
spellingShingle | Chemical Biology Jiang, Zongzhe Wan, Shengrong Xing, Bowen Wild-type menin is rapidly degraded via the ubiquitin-proteasome pathway in a rat insulinoma cell line |
title | Wild-type menin is rapidly degraded via the ubiquitin-proteasome pathway in a rat insulinoma cell line |
title_full | Wild-type menin is rapidly degraded via the ubiquitin-proteasome pathway in a rat insulinoma cell line |
title_fullStr | Wild-type menin is rapidly degraded via the ubiquitin-proteasome pathway in a rat insulinoma cell line |
title_full_unstemmed | Wild-type menin is rapidly degraded via the ubiquitin-proteasome pathway in a rat insulinoma cell line |
title_short | Wild-type menin is rapidly degraded via the ubiquitin-proteasome pathway in a rat insulinoma cell line |
title_sort | wild-type menin is rapidly degraded via the ubiquitin-proteasome pathway in a rat insulinoma cell line |
topic | Chemical Biology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6822493/ https://www.ncbi.nlm.nih.gov/pubmed/31652443 http://dx.doi.org/10.1042/BSR20190471 |
work_keys_str_mv | AT jiangzongzhe wildtypemeninisrapidlydegradedviatheubiquitinproteasomepathwayinaratinsulinomacellline AT wanshengrong wildtypemeninisrapidlydegradedviatheubiquitinproteasomepathwayinaratinsulinomacellline AT xingbowen wildtypemeninisrapidlydegradedviatheubiquitinproteasomepathwayinaratinsulinomacellline |