Cargando…
Mck1 kinase is a new player in the DNA damage checkpoint pathway
| Autores principales: | , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
Public Library of Science
2019
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6822710/ https://www.ncbi.nlm.nih.gov/pubmed/31671089 http://dx.doi.org/10.1371/journal.pgen.1008372 |
| _version_ | 1783464388321083392 |
|---|---|
| author | Sanvisens Delgado, Nerea Toczyski, David P. |
| author_facet | Sanvisens Delgado, Nerea Toczyski, David P. |
| author_sort | Sanvisens Delgado, Nerea |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-6822710 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2019 |
| publisher | Public Library of Science |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-68227102019-11-12 Mck1 kinase is a new player in the DNA damage checkpoint pathway Sanvisens Delgado, Nerea Toczyski, David P. PLoS Genet Perspective Public Library of Science 2019-10-31 /pmc/articles/PMC6822710/ /pubmed/31671089 http://dx.doi.org/10.1371/journal.pgen.1008372 Text en © 2019 Sanvisens Delgado, Toczyski http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. |
| spellingShingle | Perspective Sanvisens Delgado, Nerea Toczyski, David P. Mck1 kinase is a new player in the DNA damage checkpoint pathway |
| title | Mck1 kinase is a new player in the DNA damage checkpoint pathway |
| title_full | Mck1 kinase is a new player in the DNA damage checkpoint pathway |
| title_fullStr | Mck1 kinase is a new player in the DNA damage checkpoint pathway |
| title_full_unstemmed | Mck1 kinase is a new player in the DNA damage checkpoint pathway |
| title_short | Mck1 kinase is a new player in the DNA damage checkpoint pathway |
| title_sort | mck1 kinase is a new player in the dna damage checkpoint pathway |
| topic | Perspective |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6822710/ https://www.ncbi.nlm.nih.gov/pubmed/31671089 http://dx.doi.org/10.1371/journal.pgen.1008372 |
| work_keys_str_mv | AT sanvisensdelgadonerea mck1kinaseisanewplayerinthednadamagecheckpointpathway AT toczyskidavidp mck1kinaseisanewplayerinthednadamagecheckpointpathway |