Cargando…
Qishen capsule safely boosts cardiac function and angiogenesis via the MEK/ERK pathway in a rat myocardial infarction model
BACKGROUND: Qishen (QS) capsules, a Traditional Chinese Medicine, has been widely used to treat coronary heart disease in China. However, evidence of its effectiveness remains unclear. METHODS: To explore whether QS has cardioprotective efficacy and/or promotes angiogenesis after myocardial infarcti...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Science Press
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6828606/ https://www.ncbi.nlm.nih.gov/pubmed/31700516 http://dx.doi.org/10.11909/j.issn.1671-5411.2019.10.008 |
_version_ | 1783465384361328640 |
---|---|
author | Guo, Cai-Xia Li, Zhi-Yuan Niu, Jin-Bang Fan, Shuan-Cheng Yan, Si-Yu Lu, Pei-Pei Su, Yan-Ni Ma, Li-Hong |
author_facet | Guo, Cai-Xia Li, Zhi-Yuan Niu, Jin-Bang Fan, Shuan-Cheng Yan, Si-Yu Lu, Pei-Pei Su, Yan-Ni Ma, Li-Hong |
author_sort | Guo, Cai-Xia |
collection | PubMed |
description | BACKGROUND: Qishen (QS) capsules, a Traditional Chinese Medicine, has been widely used to treat coronary heart disease in China. However, evidence of its effectiveness remains unclear. METHODS: To explore whether QS has cardioprotective efficacy and/or promotes angiogenesis after myocardial infarction (MI), we performed experiments in a preclinical rat MI model. One month after left anterior descending coronary artery ligation, the rats received either QS solution (0.4 g/kg/day) or the same volume of saline by intragastric injection for four weeks. RESULTS: Echocardiographic and hemodynamic analyses demonstrated relatively preserved cardiac function in MI rats administered QS. Indeed, QS treatment was associated with reduced infarct scar size and heart weight index, and these beneficial effects were responsible for enhancing angiogenesis. Mechanistically, QS treatment increased phosphorylation of protein kinase B (Akt) and downregulated phosphorylation of mitogen-activated protein kinase/extracellular-regulated kinase (MEK/ERK). CONCLUSIONS: QS therapy can improve the cardiac function of rats after MI by an underlying mechanism involving increased angiogenesis, at least partially via activation of the Akt signaling pathway and inhibition of MEK/ERK phosphorylation. |
format | Online Article Text |
id | pubmed-6828606 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Science Press |
record_format | MEDLINE/PubMed |
spelling | pubmed-68286062019-11-07 Qishen capsule safely boosts cardiac function and angiogenesis via the MEK/ERK pathway in a rat myocardial infarction model Guo, Cai-Xia Li, Zhi-Yuan Niu, Jin-Bang Fan, Shuan-Cheng Yan, Si-Yu Lu, Pei-Pei Su, Yan-Ni Ma, Li-Hong J Geriatr Cardiol Research Article BACKGROUND: Qishen (QS) capsules, a Traditional Chinese Medicine, has been widely used to treat coronary heart disease in China. However, evidence of its effectiveness remains unclear. METHODS: To explore whether QS has cardioprotective efficacy and/or promotes angiogenesis after myocardial infarction (MI), we performed experiments in a preclinical rat MI model. One month after left anterior descending coronary artery ligation, the rats received either QS solution (0.4 g/kg/day) or the same volume of saline by intragastric injection for four weeks. RESULTS: Echocardiographic and hemodynamic analyses demonstrated relatively preserved cardiac function in MI rats administered QS. Indeed, QS treatment was associated with reduced infarct scar size and heart weight index, and these beneficial effects were responsible for enhancing angiogenesis. Mechanistically, QS treatment increased phosphorylation of protein kinase B (Akt) and downregulated phosphorylation of mitogen-activated protein kinase/extracellular-regulated kinase (MEK/ERK). CONCLUSIONS: QS therapy can improve the cardiac function of rats after MI by an underlying mechanism involving increased angiogenesis, at least partially via activation of the Akt signaling pathway and inhibition of MEK/ERK phosphorylation. Science Press 2019-10 /pmc/articles/PMC6828606/ /pubmed/31700516 http://dx.doi.org/10.11909/j.issn.1671-5411.2019.10.008 Text en Institute of Geriatric Cardiology http://creativecommons.org/licenses/by-nc-sa/3.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution-NonCommercial-ShareAlike 3.0 Unported License, which allows readers to alter, transform, or build upon the article and then distribute the resulting work under the same or similar license to this one. The work must be attributed back to the original author and commercial use is not permitted without specific permission. |
spellingShingle | Research Article Guo, Cai-Xia Li, Zhi-Yuan Niu, Jin-Bang Fan, Shuan-Cheng Yan, Si-Yu Lu, Pei-Pei Su, Yan-Ni Ma, Li-Hong Qishen capsule safely boosts cardiac function and angiogenesis via the MEK/ERK pathway in a rat myocardial infarction model |
title | Qishen capsule safely boosts cardiac function and angiogenesis via the MEK/ERK pathway in a rat myocardial infarction model |
title_full | Qishen capsule safely boosts cardiac function and angiogenesis via the MEK/ERK pathway in a rat myocardial infarction model |
title_fullStr | Qishen capsule safely boosts cardiac function and angiogenesis via the MEK/ERK pathway in a rat myocardial infarction model |
title_full_unstemmed | Qishen capsule safely boosts cardiac function and angiogenesis via the MEK/ERK pathway in a rat myocardial infarction model |
title_short | Qishen capsule safely boosts cardiac function and angiogenesis via the MEK/ERK pathway in a rat myocardial infarction model |
title_sort | qishen capsule safely boosts cardiac function and angiogenesis via the mek/erk pathway in a rat myocardial infarction model |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6828606/ https://www.ncbi.nlm.nih.gov/pubmed/31700516 http://dx.doi.org/10.11909/j.issn.1671-5411.2019.10.008 |
work_keys_str_mv | AT guocaixia qishencapsulesafelyboostscardiacfunctionandangiogenesisviathemekerkpathwayinaratmyocardialinfarctionmodel AT lizhiyuan qishencapsulesafelyboostscardiacfunctionandangiogenesisviathemekerkpathwayinaratmyocardialinfarctionmodel AT niujinbang qishencapsulesafelyboostscardiacfunctionandangiogenesisviathemekerkpathwayinaratmyocardialinfarctionmodel AT fanshuancheng qishencapsulesafelyboostscardiacfunctionandangiogenesisviathemekerkpathwayinaratmyocardialinfarctionmodel AT yansiyu qishencapsulesafelyboostscardiacfunctionandangiogenesisviathemekerkpathwayinaratmyocardialinfarctionmodel AT lupeipei qishencapsulesafelyboostscardiacfunctionandangiogenesisviathemekerkpathwayinaratmyocardialinfarctionmodel AT suyanni qishencapsulesafelyboostscardiacfunctionandangiogenesisviathemekerkpathwayinaratmyocardialinfarctionmodel AT malihong qishencapsulesafelyboostscardiacfunctionandangiogenesisviathemekerkpathwayinaratmyocardialinfarctionmodel |