Cargando…

Qishen capsule safely boosts cardiac function and angiogenesis via the MEK/ERK pathway in a rat myocardial infarction model

BACKGROUND: Qishen (QS) capsules, a Traditional Chinese Medicine, has been widely used to treat coronary heart disease in China. However, evidence of its effectiveness remains unclear. METHODS: To explore whether QS has cardioprotective efficacy and/or promotes angiogenesis after myocardial infarcti...

Descripción completa

Detalles Bibliográficos
Autores principales: Guo, Cai-Xia, Li, Zhi-Yuan, Niu, Jin-Bang, Fan, Shuan-Cheng, Yan, Si-Yu, Lu, Pei-Pei, Su, Yan-Ni, Ma, Li-Hong
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Science Press 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6828606/
https://www.ncbi.nlm.nih.gov/pubmed/31700516
http://dx.doi.org/10.11909/j.issn.1671-5411.2019.10.008
_version_ 1783465384361328640
author Guo, Cai-Xia
Li, Zhi-Yuan
Niu, Jin-Bang
Fan, Shuan-Cheng
Yan, Si-Yu
Lu, Pei-Pei
Su, Yan-Ni
Ma, Li-Hong
author_facet Guo, Cai-Xia
Li, Zhi-Yuan
Niu, Jin-Bang
Fan, Shuan-Cheng
Yan, Si-Yu
Lu, Pei-Pei
Su, Yan-Ni
Ma, Li-Hong
author_sort Guo, Cai-Xia
collection PubMed
description BACKGROUND: Qishen (QS) capsules, a Traditional Chinese Medicine, has been widely used to treat coronary heart disease in China. However, evidence of its effectiveness remains unclear. METHODS: To explore whether QS has cardioprotective efficacy and/or promotes angiogenesis after myocardial infarction (MI), we performed experiments in a preclinical rat MI model. One month after left anterior descending coronary artery ligation, the rats received either QS solution (0.4 g/kg/day) or the same volume of saline by intragastric injection for four weeks. RESULTS: Echocardiographic and hemodynamic analyses demonstrated relatively preserved cardiac function in MI rats administered QS. Indeed, QS treatment was associated with reduced infarct scar size and heart weight index, and these beneficial effects were responsible for enhancing angiogenesis. Mechanistically, QS treatment increased phosphorylation of protein kinase B (Akt) and downregulated phosphorylation of mitogen-activated protein kinase/extracellular-regulated kinase (MEK/ERK). CONCLUSIONS: QS therapy can improve the cardiac function of rats after MI by an underlying mechanism involving increased angiogenesis, at least partially via activation of the Akt signaling pathway and inhibition of MEK/ERK phosphorylation.
format Online
Article
Text
id pubmed-6828606
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Science Press
record_format MEDLINE/PubMed
spelling pubmed-68286062019-11-07 Qishen capsule safely boosts cardiac function and angiogenesis via the MEK/ERK pathway in a rat myocardial infarction model Guo, Cai-Xia Li, Zhi-Yuan Niu, Jin-Bang Fan, Shuan-Cheng Yan, Si-Yu Lu, Pei-Pei Su, Yan-Ni Ma, Li-Hong J Geriatr Cardiol Research Article BACKGROUND: Qishen (QS) capsules, a Traditional Chinese Medicine, has been widely used to treat coronary heart disease in China. However, evidence of its effectiveness remains unclear. METHODS: To explore whether QS has cardioprotective efficacy and/or promotes angiogenesis after myocardial infarction (MI), we performed experiments in a preclinical rat MI model. One month after left anterior descending coronary artery ligation, the rats received either QS solution (0.4 g/kg/day) or the same volume of saline by intragastric injection for four weeks. RESULTS: Echocardiographic and hemodynamic analyses demonstrated relatively preserved cardiac function in MI rats administered QS. Indeed, QS treatment was associated with reduced infarct scar size and heart weight index, and these beneficial effects were responsible for enhancing angiogenesis. Mechanistically, QS treatment increased phosphorylation of protein kinase B (Akt) and downregulated phosphorylation of mitogen-activated protein kinase/extracellular-regulated kinase (MEK/ERK). CONCLUSIONS: QS therapy can improve the cardiac function of rats after MI by an underlying mechanism involving increased angiogenesis, at least partially via activation of the Akt signaling pathway and inhibition of MEK/ERK phosphorylation. Science Press 2019-10 /pmc/articles/PMC6828606/ /pubmed/31700516 http://dx.doi.org/10.11909/j.issn.1671-5411.2019.10.008 Text en Institute of Geriatric Cardiology http://creativecommons.org/licenses/by-nc-sa/3.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution-NonCommercial-ShareAlike 3.0 Unported License, which allows readers to alter, transform, or build upon the article and then distribute the resulting work under the same or similar license to this one. The work must be attributed back to the original author and commercial use is not permitted without specific permission.
spellingShingle Research Article
Guo, Cai-Xia
Li, Zhi-Yuan
Niu, Jin-Bang
Fan, Shuan-Cheng
Yan, Si-Yu
Lu, Pei-Pei
Su, Yan-Ni
Ma, Li-Hong
Qishen capsule safely boosts cardiac function and angiogenesis via the MEK/ERK pathway in a rat myocardial infarction model
title Qishen capsule safely boosts cardiac function and angiogenesis via the MEK/ERK pathway in a rat myocardial infarction model
title_full Qishen capsule safely boosts cardiac function and angiogenesis via the MEK/ERK pathway in a rat myocardial infarction model
title_fullStr Qishen capsule safely boosts cardiac function and angiogenesis via the MEK/ERK pathway in a rat myocardial infarction model
title_full_unstemmed Qishen capsule safely boosts cardiac function and angiogenesis via the MEK/ERK pathway in a rat myocardial infarction model
title_short Qishen capsule safely boosts cardiac function and angiogenesis via the MEK/ERK pathway in a rat myocardial infarction model
title_sort qishen capsule safely boosts cardiac function and angiogenesis via the mek/erk pathway in a rat myocardial infarction model
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6828606/
https://www.ncbi.nlm.nih.gov/pubmed/31700516
http://dx.doi.org/10.11909/j.issn.1671-5411.2019.10.008
work_keys_str_mv AT guocaixia qishencapsulesafelyboostscardiacfunctionandangiogenesisviathemekerkpathwayinaratmyocardialinfarctionmodel
AT lizhiyuan qishencapsulesafelyboostscardiacfunctionandangiogenesisviathemekerkpathwayinaratmyocardialinfarctionmodel
AT niujinbang qishencapsulesafelyboostscardiacfunctionandangiogenesisviathemekerkpathwayinaratmyocardialinfarctionmodel
AT fanshuancheng qishencapsulesafelyboostscardiacfunctionandangiogenesisviathemekerkpathwayinaratmyocardialinfarctionmodel
AT yansiyu qishencapsulesafelyboostscardiacfunctionandangiogenesisviathemekerkpathwayinaratmyocardialinfarctionmodel
AT lupeipei qishencapsulesafelyboostscardiacfunctionandangiogenesisviathemekerkpathwayinaratmyocardialinfarctionmodel
AT suyanni qishencapsulesafelyboostscardiacfunctionandangiogenesisviathemekerkpathwayinaratmyocardialinfarctionmodel
AT malihong qishencapsulesafelyboostscardiacfunctionandangiogenesisviathemekerkpathwayinaratmyocardialinfarctionmodel