Cargando…
The Detection of CMV in Saliva Can Mark a Systemic Infection with CMV in Renal Transplant Recipients
Human cytomegalovirus (CMV) is often transmitted through saliva. The salivary gland is a site of CMV replication and saliva can be used to diagnose congenital CMV infections. CMV replication is monitored in whole blood or plasma in renal transplant recipients (RTR) and associates with clinical disea...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6829882/ https://www.ncbi.nlm.nih.gov/pubmed/31652514 http://dx.doi.org/10.3390/ijms20205230 |
_version_ | 1783465662348263424 |
---|---|
author | Waters, Shelley Lee, Silvia Lloyd, Megan Irish, Ashley Price, Patricia |
author_facet | Waters, Shelley Lee, Silvia Lloyd, Megan Irish, Ashley Price, Patricia |
author_sort | Waters, Shelley |
collection | PubMed |
description | Human cytomegalovirus (CMV) is often transmitted through saliva. The salivary gland is a site of CMV replication and saliva can be used to diagnose congenital CMV infections. CMV replication is monitored in whole blood or plasma in renal transplant recipients (RTR) and associates with clinical disease. However, these assays may not detect replication in the salivary gland and there is little data linking detection in saliva with systemic infection and clinical sequelae. RTR (n = 82) were recruited > 2 years after transplantation. An in-house quantitative PCR assay was used to detect CMV UL54 in saliva samples. CMV DNA was sought in plasma using a commercial assay. Vascular health was predicted using flow mediated dilatation (FMD) and plasma biomarkers. CMV-reactive antibodies were quantified by ELISA and circulating CMV-specific T-cells by an interferon-γ ELISpot assay. Vδ2(−) γδ T-cells were detected using multicolor flow cytometry reflecting population expansion after CMV infection. The presence of CMV DNA in saliva and plasma associated with plasma levels of antibodies reactive with CMV gB and with populations of circulating Vδ2(−) γδ T -cells (p < 0.01). T-cells reactive to CMV immediate early (IE)-1 protein were generally lower in patients with CMV DNA in saliva or plasma, but the level of significance varied (p = 0.02–0.16). Additionally, CMV DNA in saliva or plasma associated weakly with impaired FMD (p = 0.06–0.09). The data suggest that CMV detected in saliva reflects systemic infections in adult RTR. |
format | Online Article Text |
id | pubmed-6829882 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-68298822019-11-18 The Detection of CMV in Saliva Can Mark a Systemic Infection with CMV in Renal Transplant Recipients Waters, Shelley Lee, Silvia Lloyd, Megan Irish, Ashley Price, Patricia Int J Mol Sci Article Human cytomegalovirus (CMV) is often transmitted through saliva. The salivary gland is a site of CMV replication and saliva can be used to diagnose congenital CMV infections. CMV replication is monitored in whole blood or plasma in renal transplant recipients (RTR) and associates with clinical disease. However, these assays may not detect replication in the salivary gland and there is little data linking detection in saliva with systemic infection and clinical sequelae. RTR (n = 82) were recruited > 2 years after transplantation. An in-house quantitative PCR assay was used to detect CMV UL54 in saliva samples. CMV DNA was sought in plasma using a commercial assay. Vascular health was predicted using flow mediated dilatation (FMD) and plasma biomarkers. CMV-reactive antibodies were quantified by ELISA and circulating CMV-specific T-cells by an interferon-γ ELISpot assay. Vδ2(−) γδ T-cells were detected using multicolor flow cytometry reflecting population expansion after CMV infection. The presence of CMV DNA in saliva and plasma associated with plasma levels of antibodies reactive with CMV gB and with populations of circulating Vδ2(−) γδ T -cells (p < 0.01). T-cells reactive to CMV immediate early (IE)-1 protein were generally lower in patients with CMV DNA in saliva or plasma, but the level of significance varied (p = 0.02–0.16). Additionally, CMV DNA in saliva or plasma associated weakly with impaired FMD (p = 0.06–0.09). The data suggest that CMV detected in saliva reflects systemic infections in adult RTR. MDPI 2019-10-22 /pmc/articles/PMC6829882/ /pubmed/31652514 http://dx.doi.org/10.3390/ijms20205230 Text en © 2019 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Waters, Shelley Lee, Silvia Lloyd, Megan Irish, Ashley Price, Patricia The Detection of CMV in Saliva Can Mark a Systemic Infection with CMV in Renal Transplant Recipients |
title | The Detection of CMV in Saliva Can Mark a Systemic Infection with CMV in Renal Transplant Recipients |
title_full | The Detection of CMV in Saliva Can Mark a Systemic Infection with CMV in Renal Transplant Recipients |
title_fullStr | The Detection of CMV in Saliva Can Mark a Systemic Infection with CMV in Renal Transplant Recipients |
title_full_unstemmed | The Detection of CMV in Saliva Can Mark a Systemic Infection with CMV in Renal Transplant Recipients |
title_short | The Detection of CMV in Saliva Can Mark a Systemic Infection with CMV in Renal Transplant Recipients |
title_sort | detection of cmv in saliva can mark a systemic infection with cmv in renal transplant recipients |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6829882/ https://www.ncbi.nlm.nih.gov/pubmed/31652514 http://dx.doi.org/10.3390/ijms20205230 |
work_keys_str_mv | AT watersshelley thedetectionofcmvinsalivacanmarkasystemicinfectionwithcmvinrenaltransplantrecipients AT leesilvia thedetectionofcmvinsalivacanmarkasystemicinfectionwithcmvinrenaltransplantrecipients AT lloydmegan thedetectionofcmvinsalivacanmarkasystemicinfectionwithcmvinrenaltransplantrecipients AT irishashley thedetectionofcmvinsalivacanmarkasystemicinfectionwithcmvinrenaltransplantrecipients AT pricepatricia thedetectionofcmvinsalivacanmarkasystemicinfectionwithcmvinrenaltransplantrecipients AT watersshelley detectionofcmvinsalivacanmarkasystemicinfectionwithcmvinrenaltransplantrecipients AT leesilvia detectionofcmvinsalivacanmarkasystemicinfectionwithcmvinrenaltransplantrecipients AT lloydmegan detectionofcmvinsalivacanmarkasystemicinfectionwithcmvinrenaltransplantrecipients AT irishashley detectionofcmvinsalivacanmarkasystemicinfectionwithcmvinrenaltransplantrecipients AT pricepatricia detectionofcmvinsalivacanmarkasystemicinfectionwithcmvinrenaltransplantrecipients |