Cargando…

The Detection of CMV in Saliva Can Mark a Systemic Infection with CMV in Renal Transplant Recipients

Human cytomegalovirus (CMV) is often transmitted through saliva. The salivary gland is a site of CMV replication and saliva can be used to diagnose congenital CMV infections. CMV replication is monitored in whole blood or plasma in renal transplant recipients (RTR) and associates with clinical disea...

Descripción completa

Detalles Bibliográficos
Autores principales: Waters, Shelley, Lee, Silvia, Lloyd, Megan, Irish, Ashley, Price, Patricia
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6829882/
https://www.ncbi.nlm.nih.gov/pubmed/31652514
http://dx.doi.org/10.3390/ijms20205230
_version_ 1783465662348263424
author Waters, Shelley
Lee, Silvia
Lloyd, Megan
Irish, Ashley
Price, Patricia
author_facet Waters, Shelley
Lee, Silvia
Lloyd, Megan
Irish, Ashley
Price, Patricia
author_sort Waters, Shelley
collection PubMed
description Human cytomegalovirus (CMV) is often transmitted through saliva. The salivary gland is a site of CMV replication and saliva can be used to diagnose congenital CMV infections. CMV replication is monitored in whole blood or plasma in renal transplant recipients (RTR) and associates with clinical disease. However, these assays may not detect replication in the salivary gland and there is little data linking detection in saliva with systemic infection and clinical sequelae. RTR (n = 82) were recruited > 2 years after transplantation. An in-house quantitative PCR assay was used to detect CMV UL54 in saliva samples. CMV DNA was sought in plasma using a commercial assay. Vascular health was predicted using flow mediated dilatation (FMD) and plasma biomarkers. CMV-reactive antibodies were quantified by ELISA and circulating CMV-specific T-cells by an interferon-γ ELISpot assay. Vδ2(−) γδ T-cells were detected using multicolor flow cytometry reflecting population expansion after CMV infection. The presence of CMV DNA in saliva and plasma associated with plasma levels of antibodies reactive with CMV gB and with populations of circulating Vδ2(−) γδ T -cells (p < 0.01). T-cells reactive to CMV immediate early (IE)-1 protein were generally lower in patients with CMV DNA in saliva or plasma, but the level of significance varied (p = 0.02–0.16). Additionally, CMV DNA in saliva or plasma associated weakly with impaired FMD (p = 0.06–0.09). The data suggest that CMV detected in saliva reflects systemic infections in adult RTR.
format Online
Article
Text
id pubmed-6829882
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-68298822019-11-18 The Detection of CMV in Saliva Can Mark a Systemic Infection with CMV in Renal Transplant Recipients Waters, Shelley Lee, Silvia Lloyd, Megan Irish, Ashley Price, Patricia Int J Mol Sci Article Human cytomegalovirus (CMV) is often transmitted through saliva. The salivary gland is a site of CMV replication and saliva can be used to diagnose congenital CMV infections. CMV replication is monitored in whole blood or plasma in renal transplant recipients (RTR) and associates with clinical disease. However, these assays may not detect replication in the salivary gland and there is little data linking detection in saliva with systemic infection and clinical sequelae. RTR (n = 82) were recruited > 2 years after transplantation. An in-house quantitative PCR assay was used to detect CMV UL54 in saliva samples. CMV DNA was sought in plasma using a commercial assay. Vascular health was predicted using flow mediated dilatation (FMD) and plasma biomarkers. CMV-reactive antibodies were quantified by ELISA and circulating CMV-specific T-cells by an interferon-γ ELISpot assay. Vδ2(−) γδ T-cells were detected using multicolor flow cytometry reflecting population expansion after CMV infection. The presence of CMV DNA in saliva and plasma associated with plasma levels of antibodies reactive with CMV gB and with populations of circulating Vδ2(−) γδ T -cells (p < 0.01). T-cells reactive to CMV immediate early (IE)-1 protein were generally lower in patients with CMV DNA in saliva or plasma, but the level of significance varied (p = 0.02–0.16). Additionally, CMV DNA in saliva or plasma associated weakly with impaired FMD (p = 0.06–0.09). The data suggest that CMV detected in saliva reflects systemic infections in adult RTR. MDPI 2019-10-22 /pmc/articles/PMC6829882/ /pubmed/31652514 http://dx.doi.org/10.3390/ijms20205230 Text en © 2019 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Waters, Shelley
Lee, Silvia
Lloyd, Megan
Irish, Ashley
Price, Patricia
The Detection of CMV in Saliva Can Mark a Systemic Infection with CMV in Renal Transplant Recipients
title The Detection of CMV in Saliva Can Mark a Systemic Infection with CMV in Renal Transplant Recipients
title_full The Detection of CMV in Saliva Can Mark a Systemic Infection with CMV in Renal Transplant Recipients
title_fullStr The Detection of CMV in Saliva Can Mark a Systemic Infection with CMV in Renal Transplant Recipients
title_full_unstemmed The Detection of CMV in Saliva Can Mark a Systemic Infection with CMV in Renal Transplant Recipients
title_short The Detection of CMV in Saliva Can Mark a Systemic Infection with CMV in Renal Transplant Recipients
title_sort detection of cmv in saliva can mark a systemic infection with cmv in renal transplant recipients
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6829882/
https://www.ncbi.nlm.nih.gov/pubmed/31652514
http://dx.doi.org/10.3390/ijms20205230
work_keys_str_mv AT watersshelley thedetectionofcmvinsalivacanmarkasystemicinfectionwithcmvinrenaltransplantrecipients
AT leesilvia thedetectionofcmvinsalivacanmarkasystemicinfectionwithcmvinrenaltransplantrecipients
AT lloydmegan thedetectionofcmvinsalivacanmarkasystemicinfectionwithcmvinrenaltransplantrecipients
AT irishashley thedetectionofcmvinsalivacanmarkasystemicinfectionwithcmvinrenaltransplantrecipients
AT pricepatricia thedetectionofcmvinsalivacanmarkasystemicinfectionwithcmvinrenaltransplantrecipients
AT watersshelley detectionofcmvinsalivacanmarkasystemicinfectionwithcmvinrenaltransplantrecipients
AT leesilvia detectionofcmvinsalivacanmarkasystemicinfectionwithcmvinrenaltransplantrecipients
AT lloydmegan detectionofcmvinsalivacanmarkasystemicinfectionwithcmvinrenaltransplantrecipients
AT irishashley detectionofcmvinsalivacanmarkasystemicinfectionwithcmvinrenaltransplantrecipients
AT pricepatricia detectionofcmvinsalivacanmarkasystemicinfectionwithcmvinrenaltransplantrecipients