Cargando…
Dysregulation of the Tryptophan Pathway Evidences Gender Differences in COPD
Increased activity of indoleamine 2,3-dioxygenase (IDO) and tryptophan hydroxylase (TPH) have been reported in individuals with chronic obstructive pulmonary disease (COPD). We therefore investigated the effect of gender stratification upon the observed levels of tryptophan metabolites in COPD. Tryp...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6835831/ https://www.ncbi.nlm.nih.gov/pubmed/31581603 http://dx.doi.org/10.3390/metabo9100212 |
_version_ | 1783466765870694400 |
---|---|
author | Naz, Shama Bhat, Maria Ståhl, Sara Forsslund, Helena Sköld, C. Magnus Wheelock, Åsa M. Wheelock, Craig E. |
author_facet | Naz, Shama Bhat, Maria Ståhl, Sara Forsslund, Helena Sköld, C. Magnus Wheelock, Åsa M. Wheelock, Craig E. |
author_sort | Naz, Shama |
collection | PubMed |
description | Increased activity of indoleamine 2,3-dioxygenase (IDO) and tryptophan hydroxylase (TPH) have been reported in individuals with chronic obstructive pulmonary disease (COPD). We therefore investigated the effect of gender stratification upon the observed levels of tryptophan metabolites in COPD. Tryptophan, serotonin, kynurenine, and kynurenic acid were quantified in serum of never-smokers (n = 39), smokers (n = 40), COPD smokers (n = 27), and COPD ex-smokers (n = 11) by liquid chromatography coupled with tandem mass spectrometry (LC–MS/MS). The individual metabolite associations with lung function, blood, and bronchoalveolar lavage (BAL) immune-cell composition, as well as chemokine and cytokine levels, were investigated. Stratification by gender and smoking status revealed that the observed alterations in kynurenine and kynurenic acid, and to a lesser extent serotonin, were prominent in males, irrespective of COPD status (kynurenine p = 0.005, kynurenic acid p = 0.009, and serotonin p = 0.02). Inferred serum IDO activity and kynurenine levels decreased in smokers relative to never-smokers (p = 0.005 and p = 0.004, respectively). In contrast, inferred tryptophan hydroxylase (TPH) activity and serotonin levels showed an increase with smoking that reached significance with COPD (p = 0.01 and p = 0.01, respectively). Serum IDO activity correlated with blood CXC chemokine ligand 9 (CXCL9, p = 0.0009, r = 0.93) and chemokine (C-C motif) ligand 4 (CCL4.(p = 0.04, r = 0.73) in female COPD smokers. Conversely, serum serotonin levels correlated with BAL CD4+ T-cells (%) (p = 0.001, r = 0.92) and CD8+ T-cells (%) (p = 0.002, r = −0.90) in female COPD smokers, but not in male COPD smokers (p = 0.1, r = 0.46 and p = 0.1, r = −0.50, respectively). IDO- and TPH-mediated tryptophan metabolites showed gender-based associations in COPD, which were primarily driven by smoking status. |
format | Online Article Text |
id | pubmed-6835831 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-68358312019-11-25 Dysregulation of the Tryptophan Pathway Evidences Gender Differences in COPD Naz, Shama Bhat, Maria Ståhl, Sara Forsslund, Helena Sköld, C. Magnus Wheelock, Åsa M. Wheelock, Craig E. Metabolites Article Increased activity of indoleamine 2,3-dioxygenase (IDO) and tryptophan hydroxylase (TPH) have been reported in individuals with chronic obstructive pulmonary disease (COPD). We therefore investigated the effect of gender stratification upon the observed levels of tryptophan metabolites in COPD. Tryptophan, serotonin, kynurenine, and kynurenic acid were quantified in serum of never-smokers (n = 39), smokers (n = 40), COPD smokers (n = 27), and COPD ex-smokers (n = 11) by liquid chromatography coupled with tandem mass spectrometry (LC–MS/MS). The individual metabolite associations with lung function, blood, and bronchoalveolar lavage (BAL) immune-cell composition, as well as chemokine and cytokine levels, were investigated. Stratification by gender and smoking status revealed that the observed alterations in kynurenine and kynurenic acid, and to a lesser extent serotonin, were prominent in males, irrespective of COPD status (kynurenine p = 0.005, kynurenic acid p = 0.009, and serotonin p = 0.02). Inferred serum IDO activity and kynurenine levels decreased in smokers relative to never-smokers (p = 0.005 and p = 0.004, respectively). In contrast, inferred tryptophan hydroxylase (TPH) activity and serotonin levels showed an increase with smoking that reached significance with COPD (p = 0.01 and p = 0.01, respectively). Serum IDO activity correlated with blood CXC chemokine ligand 9 (CXCL9, p = 0.0009, r = 0.93) and chemokine (C-C motif) ligand 4 (CCL4.(p = 0.04, r = 0.73) in female COPD smokers. Conversely, serum serotonin levels correlated with BAL CD4+ T-cells (%) (p = 0.001, r = 0.92) and CD8+ T-cells (%) (p = 0.002, r = −0.90) in female COPD smokers, but not in male COPD smokers (p = 0.1, r = 0.46 and p = 0.1, r = −0.50, respectively). IDO- and TPH-mediated tryptophan metabolites showed gender-based associations in COPD, which were primarily driven by smoking status. MDPI 2019-10-01 /pmc/articles/PMC6835831/ /pubmed/31581603 http://dx.doi.org/10.3390/metabo9100212 Text en © 2019 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Naz, Shama Bhat, Maria Ståhl, Sara Forsslund, Helena Sköld, C. Magnus Wheelock, Åsa M. Wheelock, Craig E. Dysregulation of the Tryptophan Pathway Evidences Gender Differences in COPD |
title | Dysregulation of the Tryptophan Pathway Evidences Gender Differences in COPD |
title_full | Dysregulation of the Tryptophan Pathway Evidences Gender Differences in COPD |
title_fullStr | Dysregulation of the Tryptophan Pathway Evidences Gender Differences in COPD |
title_full_unstemmed | Dysregulation of the Tryptophan Pathway Evidences Gender Differences in COPD |
title_short | Dysregulation of the Tryptophan Pathway Evidences Gender Differences in COPD |
title_sort | dysregulation of the tryptophan pathway evidences gender differences in copd |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6835831/ https://www.ncbi.nlm.nih.gov/pubmed/31581603 http://dx.doi.org/10.3390/metabo9100212 |
work_keys_str_mv | AT nazshama dysregulationofthetryptophanpathwayevidencesgenderdifferencesincopd AT bhatmaria dysregulationofthetryptophanpathwayevidencesgenderdifferencesincopd AT stahlsara dysregulationofthetryptophanpathwayevidencesgenderdifferencesincopd AT forsslundhelena dysregulationofthetryptophanpathwayevidencesgenderdifferencesincopd AT skoldcmagnus dysregulationofthetryptophanpathwayevidencesgenderdifferencesincopd AT wheelockasam dysregulationofthetryptophanpathwayevidencesgenderdifferencesincopd AT wheelockcraige dysregulationofthetryptophanpathwayevidencesgenderdifferencesincopd |