Cargando…
The Sub-Saharan Africa Regional Partnership (SHARP) for Mental Health Capacity Building: a program protocol for building implementation science and mental health research and policymaking capacity in Malawi and Tanzania
BACKGROUND: Mental health (MH) disorders in low and middle-income countries (LMICs) account for a large proportion of disease burden. While efficacious treatments exist, only 10% of those in need are able to access care. This treatment gap is fueled by structural determinants including inadequate re...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6842238/ https://www.ncbi.nlm.nih.gov/pubmed/31728158 http://dx.doi.org/10.1186/s13033-019-0327-2 |
_version_ | 1783468012184010752 |
---|---|
author | Akiba, Christopher Fittipaldi Go, Vivian Mwapasa, Victor Hosseinipour, Mina Gaynes, Bradley Neil Amberbir, Alemayehu Udedi, Michael Pence, Brian Wells |
author_facet | Akiba, Christopher Fittipaldi Go, Vivian Mwapasa, Victor Hosseinipour, Mina Gaynes, Bradley Neil Amberbir, Alemayehu Udedi, Michael Pence, Brian Wells |
author_sort | Akiba, Christopher Fittipaldi |
collection | PubMed |
description | BACKGROUND: Mental health (MH) disorders in low and middle-income countries (LMICs) account for a large proportion of disease burden. While efficacious treatments exist, only 10% of those in need are able to access care. This treatment gap is fueled by structural determinants including inadequate resource allocation and prioritization, both rooted in a lack of research and policy capacity. The goal of the Sub-Saharan Africa Regional Partnership for Mental Health Capacity Building (SHARP), based in Malawi and Tanzania, is to address those research and policy-based determinants. METHODS: SHARP aims to (1) build implementation science skills and expertise among Malawian and Tanzanian researchers in the area of mental health; (2) ensure that Malawian and Tanzanian policymakers and providers have the knowledge and skills to effectively apply research findings on evidence-based mental health programs to routine practice; and (3) strengthen dialogue between researchers, policymakers, and providers leading to efficient and sustainable scale-up of mental health services in Malawi and Tanzania. SHARP comprises five capacity building components: introductory and advanced short courses, a multifaceted dialogue, on-the-job training, pilot grants, and “mentor the mentors” courses. DISCUSSION: Program evaluation includes measuring dose delivered and received, participant knowledge and satisfaction, as well as academic output (e.g., conference posters or presentations, manuscript submissions, grant applications). The SHARP Capacity Building Program aims to make a meaningful contribution in pursuit of a model of capacity building that could be replicated in other LMICs. If impactful, the SHARP Capacity Building Program could increase the knowledge, skills, and mentorship capabilities of researchers, policymakers, and providers regarding effective scale up of evidence-based MH treatment. |
format | Online Article Text |
id | pubmed-6842238 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-68422382019-11-14 The Sub-Saharan Africa Regional Partnership (SHARP) for Mental Health Capacity Building: a program protocol for building implementation science and mental health research and policymaking capacity in Malawi and Tanzania Akiba, Christopher Fittipaldi Go, Vivian Mwapasa, Victor Hosseinipour, Mina Gaynes, Bradley Neil Amberbir, Alemayehu Udedi, Michael Pence, Brian Wells Int J Ment Health Syst Study Protocol BACKGROUND: Mental health (MH) disorders in low and middle-income countries (LMICs) account for a large proportion of disease burden. While efficacious treatments exist, only 10% of those in need are able to access care. This treatment gap is fueled by structural determinants including inadequate resource allocation and prioritization, both rooted in a lack of research and policy capacity. The goal of the Sub-Saharan Africa Regional Partnership for Mental Health Capacity Building (SHARP), based in Malawi and Tanzania, is to address those research and policy-based determinants. METHODS: SHARP aims to (1) build implementation science skills and expertise among Malawian and Tanzanian researchers in the area of mental health; (2) ensure that Malawian and Tanzanian policymakers and providers have the knowledge and skills to effectively apply research findings on evidence-based mental health programs to routine practice; and (3) strengthen dialogue between researchers, policymakers, and providers leading to efficient and sustainable scale-up of mental health services in Malawi and Tanzania. SHARP comprises five capacity building components: introductory and advanced short courses, a multifaceted dialogue, on-the-job training, pilot grants, and “mentor the mentors” courses. DISCUSSION: Program evaluation includes measuring dose delivered and received, participant knowledge and satisfaction, as well as academic output (e.g., conference posters or presentations, manuscript submissions, grant applications). The SHARP Capacity Building Program aims to make a meaningful contribution in pursuit of a model of capacity building that could be replicated in other LMICs. If impactful, the SHARP Capacity Building Program could increase the knowledge, skills, and mentorship capabilities of researchers, policymakers, and providers regarding effective scale up of evidence-based MH treatment. BioMed Central 2019-11-09 /pmc/articles/PMC6842238/ /pubmed/31728158 http://dx.doi.org/10.1186/s13033-019-0327-2 Text en © The Author(s) 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Study Protocol Akiba, Christopher Fittipaldi Go, Vivian Mwapasa, Victor Hosseinipour, Mina Gaynes, Bradley Neil Amberbir, Alemayehu Udedi, Michael Pence, Brian Wells The Sub-Saharan Africa Regional Partnership (SHARP) for Mental Health Capacity Building: a program protocol for building implementation science and mental health research and policymaking capacity in Malawi and Tanzania |
title | The Sub-Saharan Africa Regional Partnership (SHARP) for Mental Health Capacity Building: a program protocol for building implementation science and mental health research and policymaking capacity in Malawi and Tanzania |
title_full | The Sub-Saharan Africa Regional Partnership (SHARP) for Mental Health Capacity Building: a program protocol for building implementation science and mental health research and policymaking capacity in Malawi and Tanzania |
title_fullStr | The Sub-Saharan Africa Regional Partnership (SHARP) for Mental Health Capacity Building: a program protocol for building implementation science and mental health research and policymaking capacity in Malawi and Tanzania |
title_full_unstemmed | The Sub-Saharan Africa Regional Partnership (SHARP) for Mental Health Capacity Building: a program protocol for building implementation science and mental health research and policymaking capacity in Malawi and Tanzania |
title_short | The Sub-Saharan Africa Regional Partnership (SHARP) for Mental Health Capacity Building: a program protocol for building implementation science and mental health research and policymaking capacity in Malawi and Tanzania |
title_sort | sub-saharan africa regional partnership (sharp) for mental health capacity building: a program protocol for building implementation science and mental health research and policymaking capacity in malawi and tanzania |
topic | Study Protocol |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6842238/ https://www.ncbi.nlm.nih.gov/pubmed/31728158 http://dx.doi.org/10.1186/s13033-019-0327-2 |
work_keys_str_mv | AT akibachristopherfittipaldi thesubsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania AT govivian thesubsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania AT mwapasavictor thesubsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania AT hosseinipourmina thesubsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania AT gaynesbradleyneil thesubsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania AT amberbiralemayehu thesubsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania AT udedimichael thesubsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania AT pencebrianwells thesubsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania AT akibachristopherfittipaldi subsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania AT govivian subsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania AT mwapasavictor subsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania AT hosseinipourmina subsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania AT gaynesbradleyneil subsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania AT amberbiralemayehu subsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania AT udedimichael subsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania AT pencebrianwells subsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania |