Cargando…

The Sub-Saharan Africa Regional Partnership (SHARP) for Mental Health Capacity Building: a program protocol for building implementation science and mental health research and policymaking capacity in Malawi and Tanzania

BACKGROUND: Mental health (MH) disorders in low and middle-income countries (LMICs) account for a large proportion of disease burden. While efficacious treatments exist, only 10% of those in need are able to access care. This treatment gap is fueled by structural determinants including inadequate re...

Descripción completa

Detalles Bibliográficos
Autores principales: Akiba, Christopher Fittipaldi, Go, Vivian, Mwapasa, Victor, Hosseinipour, Mina, Gaynes, Bradley Neil, Amberbir, Alemayehu, Udedi, Michael, Pence, Brian Wells
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6842238/
https://www.ncbi.nlm.nih.gov/pubmed/31728158
http://dx.doi.org/10.1186/s13033-019-0327-2
_version_ 1783468012184010752
author Akiba, Christopher Fittipaldi
Go, Vivian
Mwapasa, Victor
Hosseinipour, Mina
Gaynes, Bradley Neil
Amberbir, Alemayehu
Udedi, Michael
Pence, Brian Wells
author_facet Akiba, Christopher Fittipaldi
Go, Vivian
Mwapasa, Victor
Hosseinipour, Mina
Gaynes, Bradley Neil
Amberbir, Alemayehu
Udedi, Michael
Pence, Brian Wells
author_sort Akiba, Christopher Fittipaldi
collection PubMed
description BACKGROUND: Mental health (MH) disorders in low and middle-income countries (LMICs) account for a large proportion of disease burden. While efficacious treatments exist, only 10% of those in need are able to access care. This treatment gap is fueled by structural determinants including inadequate resource allocation and prioritization, both rooted in a lack of research and policy capacity. The goal of the Sub-Saharan Africa Regional Partnership for Mental Health Capacity Building (SHARP), based in Malawi and Tanzania, is to address those research and policy-based determinants. METHODS: SHARP aims to (1) build implementation science skills and expertise among Malawian and Tanzanian researchers in the area of mental health; (2) ensure that Malawian and Tanzanian policymakers and providers have the knowledge and skills to effectively apply research findings on evidence-based mental health programs to routine practice; and (3) strengthen dialogue between researchers, policymakers, and providers leading to efficient and sustainable scale-up of mental health services in Malawi and Tanzania. SHARP comprises five capacity building components: introductory and advanced short courses, a multifaceted dialogue, on-the-job training, pilot grants, and “mentor the mentors” courses. DISCUSSION: Program evaluation includes measuring dose delivered and received, participant knowledge and satisfaction, as well as academic output (e.g., conference posters or presentations, manuscript submissions, grant applications). The SHARP Capacity Building Program aims to make a meaningful contribution in pursuit of a model of capacity building that could be replicated in other LMICs. If impactful, the SHARP Capacity Building Program could increase the knowledge, skills, and mentorship capabilities of researchers, policymakers, and providers regarding effective scale up of evidence-based MH treatment.
format Online
Article
Text
id pubmed-6842238
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-68422382019-11-14 The Sub-Saharan Africa Regional Partnership (SHARP) for Mental Health Capacity Building: a program protocol for building implementation science and mental health research and policymaking capacity in Malawi and Tanzania Akiba, Christopher Fittipaldi Go, Vivian Mwapasa, Victor Hosseinipour, Mina Gaynes, Bradley Neil Amberbir, Alemayehu Udedi, Michael Pence, Brian Wells Int J Ment Health Syst Study Protocol BACKGROUND: Mental health (MH) disorders in low and middle-income countries (LMICs) account for a large proportion of disease burden. While efficacious treatments exist, only 10% of those in need are able to access care. This treatment gap is fueled by structural determinants including inadequate resource allocation and prioritization, both rooted in a lack of research and policy capacity. The goal of the Sub-Saharan Africa Regional Partnership for Mental Health Capacity Building (SHARP), based in Malawi and Tanzania, is to address those research and policy-based determinants. METHODS: SHARP aims to (1) build implementation science skills and expertise among Malawian and Tanzanian researchers in the area of mental health; (2) ensure that Malawian and Tanzanian policymakers and providers have the knowledge and skills to effectively apply research findings on evidence-based mental health programs to routine practice; and (3) strengthen dialogue between researchers, policymakers, and providers leading to efficient and sustainable scale-up of mental health services in Malawi and Tanzania. SHARP comprises five capacity building components: introductory and advanced short courses, a multifaceted dialogue, on-the-job training, pilot grants, and “mentor the mentors” courses. DISCUSSION: Program evaluation includes measuring dose delivered and received, participant knowledge and satisfaction, as well as academic output (e.g., conference posters or presentations, manuscript submissions, grant applications). The SHARP Capacity Building Program aims to make a meaningful contribution in pursuit of a model of capacity building that could be replicated in other LMICs. If impactful, the SHARP Capacity Building Program could increase the knowledge, skills, and mentorship capabilities of researchers, policymakers, and providers regarding effective scale up of evidence-based MH treatment. BioMed Central 2019-11-09 /pmc/articles/PMC6842238/ /pubmed/31728158 http://dx.doi.org/10.1186/s13033-019-0327-2 Text en © The Author(s) 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Study Protocol
Akiba, Christopher Fittipaldi
Go, Vivian
Mwapasa, Victor
Hosseinipour, Mina
Gaynes, Bradley Neil
Amberbir, Alemayehu
Udedi, Michael
Pence, Brian Wells
The Sub-Saharan Africa Regional Partnership (SHARP) for Mental Health Capacity Building: a program protocol for building implementation science and mental health research and policymaking capacity in Malawi and Tanzania
title The Sub-Saharan Africa Regional Partnership (SHARP) for Mental Health Capacity Building: a program protocol for building implementation science and mental health research and policymaking capacity in Malawi and Tanzania
title_full The Sub-Saharan Africa Regional Partnership (SHARP) for Mental Health Capacity Building: a program protocol for building implementation science and mental health research and policymaking capacity in Malawi and Tanzania
title_fullStr The Sub-Saharan Africa Regional Partnership (SHARP) for Mental Health Capacity Building: a program protocol for building implementation science and mental health research and policymaking capacity in Malawi and Tanzania
title_full_unstemmed The Sub-Saharan Africa Regional Partnership (SHARP) for Mental Health Capacity Building: a program protocol for building implementation science and mental health research and policymaking capacity in Malawi and Tanzania
title_short The Sub-Saharan Africa Regional Partnership (SHARP) for Mental Health Capacity Building: a program protocol for building implementation science and mental health research and policymaking capacity in Malawi and Tanzania
title_sort sub-saharan africa regional partnership (sharp) for mental health capacity building: a program protocol for building implementation science and mental health research and policymaking capacity in malawi and tanzania
topic Study Protocol
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6842238/
https://www.ncbi.nlm.nih.gov/pubmed/31728158
http://dx.doi.org/10.1186/s13033-019-0327-2
work_keys_str_mv AT akibachristopherfittipaldi thesubsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania
AT govivian thesubsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania
AT mwapasavictor thesubsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania
AT hosseinipourmina thesubsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania
AT gaynesbradleyneil thesubsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania
AT amberbiralemayehu thesubsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania
AT udedimichael thesubsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania
AT pencebrianwells thesubsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania
AT akibachristopherfittipaldi subsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania
AT govivian subsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania
AT mwapasavictor subsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania
AT hosseinipourmina subsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania
AT gaynesbradleyneil subsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania
AT amberbiralemayehu subsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania
AT udedimichael subsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania
AT pencebrianwells subsaharanafricaregionalpartnershipsharpformentalhealthcapacitybuildingaprogramprotocolforbuildingimplementationscienceandmentalhealthresearchandpolicymakingcapacityinmalawiandtanzania