Cargando…
Anti‐retinoblastoma Protein Antibodies: A New Specificity in Systemic Lupus Erythematosus Associated With Protection Against Lupus Nephritis
OBJECTIVE: Retinoblastoma (Rb) protein is a nuclear protein with several important functions, including the ability to stabilize heterochromatin. Because antibodies against the nucleosome and chromatin are key in systemic lupus erythematosus (SLE), we sought to determine whether Rb was an autoantige...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
John Wiley and Sons Inc.
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6857985/ https://www.ncbi.nlm.nih.gov/pubmed/31777805 http://dx.doi.org/10.1002/acr2.1036 |
_version_ | 1783470861929414656 |
---|---|
author | Goules, Andreas Li, Jessica Antiochos, Brendan Goldman, Daniel W. Rosen, Antony Petri, Michelle Casciola‐Rosen, Livia |
author_facet | Goules, Andreas Li, Jessica Antiochos, Brendan Goldman, Daniel W. Rosen, Antony Petri, Michelle Casciola‐Rosen, Livia |
author_sort | Goules, Andreas |
collection | PubMed |
description | OBJECTIVE: Retinoblastoma (Rb) protein is a nuclear protein with several important functions, including the ability to stabilize heterochromatin. Because antibodies against the nucleosome and chromatin are key in systemic lupus erythematosus (SLE), we sought to determine whether Rb was an autoantigen in SLE and to evaluate any associated clinical phenotypes. METHODS: Sera from 222 patients with SLE from the Hopkins longitudinal cohort were studied. Additional cohorts tested included sera from 100 patients with primary Sjögren syndrome (pSS) (disease controls) evaluated at the Johns Hopkins Jerome L. Greene Sjögren's Center and sera from 36 healthy individuals. Anti‐Rb antibodies were assayed by immunoprecipitation of (35)S‐methionine–labeled Rb, which was generated by in vitro transcription/translation. Fisher's exact test was used for the univariate analysis. Multivariable exact logistic regression was used to model for the presence of proteinuria in patients with SLE. RESULTS: Anti‐Rb antibodies were present in 15 of 222 (6.8%) patients with SLE, in 3 of 100 patients with pSS (3%), and in 0 of 36 healthy individuals. Among patients with SLE, Rb antibodies were strongly negatively associated with proteinuria (P = 0.0031), renal involvement (odds ratio [OR] = 0.11; P = 0.01), and anemia (OR = 0.05; P < 0.0001) and were positively associated with stroke (OR = 7.65; P = 0.05). The negative association with lupus nephritis held true in multivariate models (adjusted OR = 0.11; P = 0.01). CONCLUSION: Anti‐Rb antibodies are a novel specificity not previously described in SLE. These new data define a possible SLE subset that is protected against renal involvement, is positively associated with stroke, and is not associated with antiphospholipid antibodies. |
format | Online Article Text |
id | pubmed-6857985 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | John Wiley and Sons Inc. |
record_format | MEDLINE/PubMed |
spelling | pubmed-68579852019-11-27 Anti‐retinoblastoma Protein Antibodies: A New Specificity in Systemic Lupus Erythematosus Associated With Protection Against Lupus Nephritis Goules, Andreas Li, Jessica Antiochos, Brendan Goldman, Daniel W. Rosen, Antony Petri, Michelle Casciola‐Rosen, Livia ACR Open Rheumatol Brief Report OBJECTIVE: Retinoblastoma (Rb) protein is a nuclear protein with several important functions, including the ability to stabilize heterochromatin. Because antibodies against the nucleosome and chromatin are key in systemic lupus erythematosus (SLE), we sought to determine whether Rb was an autoantigen in SLE and to evaluate any associated clinical phenotypes. METHODS: Sera from 222 patients with SLE from the Hopkins longitudinal cohort were studied. Additional cohorts tested included sera from 100 patients with primary Sjögren syndrome (pSS) (disease controls) evaluated at the Johns Hopkins Jerome L. Greene Sjögren's Center and sera from 36 healthy individuals. Anti‐Rb antibodies were assayed by immunoprecipitation of (35)S‐methionine–labeled Rb, which was generated by in vitro transcription/translation. Fisher's exact test was used for the univariate analysis. Multivariable exact logistic regression was used to model for the presence of proteinuria in patients with SLE. RESULTS: Anti‐Rb antibodies were present in 15 of 222 (6.8%) patients with SLE, in 3 of 100 patients with pSS (3%), and in 0 of 36 healthy individuals. Among patients with SLE, Rb antibodies were strongly negatively associated with proteinuria (P = 0.0031), renal involvement (odds ratio [OR] = 0.11; P = 0.01), and anemia (OR = 0.05; P < 0.0001) and were positively associated with stroke (OR = 7.65; P = 0.05). The negative association with lupus nephritis held true in multivariate models (adjusted OR = 0.11; P = 0.01). CONCLUSION: Anti‐Rb antibodies are a novel specificity not previously described in SLE. These new data define a possible SLE subset that is protected against renal involvement, is positively associated with stroke, and is not associated with antiphospholipid antibodies. John Wiley and Sons Inc. 2019-06-06 /pmc/articles/PMC6857985/ /pubmed/31777805 http://dx.doi.org/10.1002/acr2.1036 Text en © 2019 The Authors. ACR Open Rheumatology published by Wiley Periodicals, Inc. on behalf of American College of Rheumatology. This is an open access article under the terms of the http://creativecommons.org/licenses/by-nc/4.0/ License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited and is not used for commercial purposes. |
spellingShingle | Brief Report Goules, Andreas Li, Jessica Antiochos, Brendan Goldman, Daniel W. Rosen, Antony Petri, Michelle Casciola‐Rosen, Livia Anti‐retinoblastoma Protein Antibodies: A New Specificity in Systemic Lupus Erythematosus Associated With Protection Against Lupus Nephritis |
title | Anti‐retinoblastoma Protein Antibodies: A New Specificity in Systemic Lupus Erythematosus Associated With Protection Against Lupus Nephritis |
title_full | Anti‐retinoblastoma Protein Antibodies: A New Specificity in Systemic Lupus Erythematosus Associated With Protection Against Lupus Nephritis |
title_fullStr | Anti‐retinoblastoma Protein Antibodies: A New Specificity in Systemic Lupus Erythematosus Associated With Protection Against Lupus Nephritis |
title_full_unstemmed | Anti‐retinoblastoma Protein Antibodies: A New Specificity in Systemic Lupus Erythematosus Associated With Protection Against Lupus Nephritis |
title_short | Anti‐retinoblastoma Protein Antibodies: A New Specificity in Systemic Lupus Erythematosus Associated With Protection Against Lupus Nephritis |
title_sort | anti‐retinoblastoma protein antibodies: a new specificity in systemic lupus erythematosus associated with protection against lupus nephritis |
topic | Brief Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6857985/ https://www.ncbi.nlm.nih.gov/pubmed/31777805 http://dx.doi.org/10.1002/acr2.1036 |
work_keys_str_mv | AT goulesandreas antiretinoblastomaproteinantibodiesanewspecificityinsystemiclupuserythematosusassociatedwithprotectionagainstlupusnephritis AT lijessica antiretinoblastomaproteinantibodiesanewspecificityinsystemiclupuserythematosusassociatedwithprotectionagainstlupusnephritis AT antiochosbrendan antiretinoblastomaproteinantibodiesanewspecificityinsystemiclupuserythematosusassociatedwithprotectionagainstlupusnephritis AT goldmandanielw antiretinoblastomaproteinantibodiesanewspecificityinsystemiclupuserythematosusassociatedwithprotectionagainstlupusnephritis AT rosenantony antiretinoblastomaproteinantibodiesanewspecificityinsystemiclupuserythematosusassociatedwithprotectionagainstlupusnephritis AT petrimichelle antiretinoblastomaproteinantibodiesanewspecificityinsystemiclupuserythematosusassociatedwithprotectionagainstlupusnephritis AT casciolarosenlivia antiretinoblastomaproteinantibodiesanewspecificityinsystemiclupuserythematosusassociatedwithprotectionagainstlupusnephritis |