Cargando…
Utilizing perspectives from HIV-infected women, male partners and healthcare providers to design family planning SMS in Kenya: a qualitative study
BACKGROUND: Short message service (SMS) presents an opportunity to expand the reach of care and improve reproductive health outcomes. SMS could increase family planning (FP) use through education, support and demand generation. The purpose of this analysis is to determine the perspectives of potenti...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6873397/ https://www.ncbi.nlm.nih.gov/pubmed/31752872 http://dx.doi.org/10.1186/s12913-019-4708-7 |
_version_ | 1783472642285633536 |
---|---|
author | Lewis, Karren Harrington, Elizabeth K. Matemo, Daniel Drake, Alison L. Ronen, Keshet O’Malley, Gabrielle Kinuthia, John John-Stewart, Grace Unger, Jennifer A. |
author_facet | Lewis, Karren Harrington, Elizabeth K. Matemo, Daniel Drake, Alison L. Ronen, Keshet O’Malley, Gabrielle Kinuthia, John John-Stewart, Grace Unger, Jennifer A. |
author_sort | Lewis, Karren |
collection | PubMed |
description | BACKGROUND: Short message service (SMS) presents an opportunity to expand the reach of care and improve reproductive health outcomes. SMS could increase family planning (FP) use through education, support and demand generation. The purpose of this analysis is to determine the perspectives of potential FP users to inform design of SMS. METHODS: We conducted focus group discussions (FGD) with HIV-infected women and in-depth interviews (IDI) with male partners and health care workers (HCW) at urban and rural clinics in Kenya to design SMS content for a randomized controlled trial. RESULTS: Women and men indicated SMS could be used as a tool to discuss FP with their partners, and help decrease misconceptions about FP. Women stated SMS could make them more comfortable discussing sensitive topics with HCWs compared to in-person discussions. However, some women expressed concerns about FP SMS particularly if they used FP covertly or feared partner disapproval of FP use. These findings were common among women who had not disclosed their status. Providers viewed SMS as an important tool for tracking patients and clinical triage in conjunction with routine clinical visits. CONCLUSION: Our findings suggest that SMS has the potential to facilitate FP education, counselling, and interaction with HCWs around FP. |
format | Online Article Text |
id | pubmed-6873397 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-68733972019-12-12 Utilizing perspectives from HIV-infected women, male partners and healthcare providers to design family planning SMS in Kenya: a qualitative study Lewis, Karren Harrington, Elizabeth K. Matemo, Daniel Drake, Alison L. Ronen, Keshet O’Malley, Gabrielle Kinuthia, John John-Stewart, Grace Unger, Jennifer A. BMC Health Serv Res Research Article BACKGROUND: Short message service (SMS) presents an opportunity to expand the reach of care and improve reproductive health outcomes. SMS could increase family planning (FP) use through education, support and demand generation. The purpose of this analysis is to determine the perspectives of potential FP users to inform design of SMS. METHODS: We conducted focus group discussions (FGD) with HIV-infected women and in-depth interviews (IDI) with male partners and health care workers (HCW) at urban and rural clinics in Kenya to design SMS content for a randomized controlled trial. RESULTS: Women and men indicated SMS could be used as a tool to discuss FP with their partners, and help decrease misconceptions about FP. Women stated SMS could make them more comfortable discussing sensitive topics with HCWs compared to in-person discussions. However, some women expressed concerns about FP SMS particularly if they used FP covertly or feared partner disapproval of FP use. These findings were common among women who had not disclosed their status. Providers viewed SMS as an important tool for tracking patients and clinical triage in conjunction with routine clinical visits. CONCLUSION: Our findings suggest that SMS has the potential to facilitate FP education, counselling, and interaction with HCWs around FP. BioMed Central 2019-11-21 /pmc/articles/PMC6873397/ /pubmed/31752872 http://dx.doi.org/10.1186/s12913-019-4708-7 Text en © The Author(s). 2019 Open Access This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Lewis, Karren Harrington, Elizabeth K. Matemo, Daniel Drake, Alison L. Ronen, Keshet O’Malley, Gabrielle Kinuthia, John John-Stewart, Grace Unger, Jennifer A. Utilizing perspectives from HIV-infected women, male partners and healthcare providers to design family planning SMS in Kenya: a qualitative study |
title | Utilizing perspectives from HIV-infected women, male partners and healthcare providers to design family planning SMS in Kenya: a qualitative study |
title_full | Utilizing perspectives from HIV-infected women, male partners and healthcare providers to design family planning SMS in Kenya: a qualitative study |
title_fullStr | Utilizing perspectives from HIV-infected women, male partners and healthcare providers to design family planning SMS in Kenya: a qualitative study |
title_full_unstemmed | Utilizing perspectives from HIV-infected women, male partners and healthcare providers to design family planning SMS in Kenya: a qualitative study |
title_short | Utilizing perspectives from HIV-infected women, male partners and healthcare providers to design family planning SMS in Kenya: a qualitative study |
title_sort | utilizing perspectives from hiv-infected women, male partners and healthcare providers to design family planning sms in kenya: a qualitative study |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6873397/ https://www.ncbi.nlm.nih.gov/pubmed/31752872 http://dx.doi.org/10.1186/s12913-019-4708-7 |
work_keys_str_mv | AT lewiskarren utilizingperspectivesfromhivinfectedwomenmalepartnersandhealthcareproviderstodesignfamilyplanningsmsinkenyaaqualitativestudy AT harringtonelizabethk utilizingperspectivesfromhivinfectedwomenmalepartnersandhealthcareproviderstodesignfamilyplanningsmsinkenyaaqualitativestudy AT matemodaniel utilizingperspectivesfromhivinfectedwomenmalepartnersandhealthcareproviderstodesignfamilyplanningsmsinkenyaaqualitativestudy AT drakealisonl utilizingperspectivesfromhivinfectedwomenmalepartnersandhealthcareproviderstodesignfamilyplanningsmsinkenyaaqualitativestudy AT ronenkeshet utilizingperspectivesfromhivinfectedwomenmalepartnersandhealthcareproviderstodesignfamilyplanningsmsinkenyaaqualitativestudy AT omalleygabrielle utilizingperspectivesfromhivinfectedwomenmalepartnersandhealthcareproviderstodesignfamilyplanningsmsinkenyaaqualitativestudy AT kinuthiajohn utilizingperspectivesfromhivinfectedwomenmalepartnersandhealthcareproviderstodesignfamilyplanningsmsinkenyaaqualitativestudy AT johnstewartgrace utilizingperspectivesfromhivinfectedwomenmalepartnersandhealthcareproviderstodesignfamilyplanningsmsinkenyaaqualitativestudy AT ungerjennifera utilizingperspectivesfromhivinfectedwomenmalepartnersandhealthcareproviderstodesignfamilyplanningsmsinkenyaaqualitativestudy |