Cargando…

Zonulin Family Peptide Levels in Ascites and Serum in Patients with Liver Cirrhosis: A Preliminary Study

INTRODUCTION: Zonulin is a protein that reversibly modulates the permeability of tight junction of the small intestine wall. As the serum concentration of “zonulin family peptides” (ZFPs) is considered to be a sensitive and useful marker of intestinal wall permeability, its serum level may affect th...

Descripción completa

Detalles Bibliográficos
Autores principales: Pietrukaniec, Marta, Migacz, Maciej, Żak-Gołąb, Agnieszka, Olszanecka-Glinianowicz, Magdalena, Chudek, Jerzy, Duława, Jan, Holecki, Michał
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Hindawi 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6875214/
https://www.ncbi.nlm.nih.gov/pubmed/31781297
http://dx.doi.org/10.1155/2019/2804091
_version_ 1783472979174227968
author Pietrukaniec, Marta
Migacz, Maciej
Żak-Gołąb, Agnieszka
Olszanecka-Glinianowicz, Magdalena
Chudek, Jerzy
Duława, Jan
Holecki, Michał
author_facet Pietrukaniec, Marta
Migacz, Maciej
Żak-Gołąb, Agnieszka
Olszanecka-Glinianowicz, Magdalena
Chudek, Jerzy
Duława, Jan
Holecki, Michał
author_sort Pietrukaniec, Marta
collection PubMed
description INTRODUCTION: Zonulin is a protein that reversibly modulates the permeability of tight junction of the small intestine wall. As the serum concentration of “zonulin family peptides” (ZFPs) is considered to be a sensitive and useful marker of intestinal wall permeability, its serum level may affect the volume of ascites fluid and change in gut microbiota. The aim of the study was to assess the association between concentrations of ZFPs in serum and ascites in relation to the severity of liver cirrhosis. METHODS: The preliminary study included 24 adult patients diagnosed with alcoholic or viral liver cirrhosis. 18 healthy adult subjects were enrolled as the control group. In patients and controls, there were measured serum and ascites (only in patients) ZFPs, serum bilirubin, creatinine, alanine aminotransferase, total protein, and C-reactive protein (CRP). RESULTS: Cirrhotic patients had lower serum hemoglobin (11.6 vs. 14.3 mg/dL; p < 0.001), platelet count (178 vs. 305 × 10(3)/mm(3); p < 0.01), total protein and albumin (58.6 vs. 74.3 g/dL; p < 0.001, 26.6 vs. 42.3 g/dL; p < 0.001, respectively), and serum ZFPs (30.5 vs. 62.0 ng/mL; p < 0.001) in comparison to controls. In patients with cirrhosis serum bilirubin, C-reactive protein level and INR were higher than in controls (3.07 vs. 0.96 mg/dL; 36.9 vs. 5 mg/L; 1.53 vs. 0.95; p < 0.001, respectively). Patients with low ZFP levels were characterized with lower ascites ZFP levels (0.25 vs. 16.4 ng/mL; p < 0.001) and ascites/serum index (0.011 vs. 0.462; p < 0.001). There were negative correlations between ascites ZFPs and platelet count (R = −0.497; p < 0.01) and positive correlation with INR (R = 0.640; p < 0.001). ZFP index positively correlated with platelet count (R = 0.726; p < 0.001) and negatively with INR (R = −0.392; p = 0.06). CONCLUSIONS: Decrease serum ZFP levels seem to reflect their decreased liver synthesis but not increased gut permeability in patients with liver cirrhosis. The physiologically low level of ZFPs in transudate is increased in exudate.
format Online
Article
Text
id pubmed-6875214
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Hindawi
record_format MEDLINE/PubMed
spelling pubmed-68752142019-11-28 Zonulin Family Peptide Levels in Ascites and Serum in Patients with Liver Cirrhosis: A Preliminary Study Pietrukaniec, Marta Migacz, Maciej Żak-Gołąb, Agnieszka Olszanecka-Glinianowicz, Magdalena Chudek, Jerzy Duława, Jan Holecki, Michał Dis Markers Research Article INTRODUCTION: Zonulin is a protein that reversibly modulates the permeability of tight junction of the small intestine wall. As the serum concentration of “zonulin family peptides” (ZFPs) is considered to be a sensitive and useful marker of intestinal wall permeability, its serum level may affect the volume of ascites fluid and change in gut microbiota. The aim of the study was to assess the association between concentrations of ZFPs in serum and ascites in relation to the severity of liver cirrhosis. METHODS: The preliminary study included 24 adult patients diagnosed with alcoholic or viral liver cirrhosis. 18 healthy adult subjects were enrolled as the control group. In patients and controls, there were measured serum and ascites (only in patients) ZFPs, serum bilirubin, creatinine, alanine aminotransferase, total protein, and C-reactive protein (CRP). RESULTS: Cirrhotic patients had lower serum hemoglobin (11.6 vs. 14.3 mg/dL; p < 0.001), platelet count (178 vs. 305 × 10(3)/mm(3); p < 0.01), total protein and albumin (58.6 vs. 74.3 g/dL; p < 0.001, 26.6 vs. 42.3 g/dL; p < 0.001, respectively), and serum ZFPs (30.5 vs. 62.0 ng/mL; p < 0.001) in comparison to controls. In patients with cirrhosis serum bilirubin, C-reactive protein level and INR were higher than in controls (3.07 vs. 0.96 mg/dL; 36.9 vs. 5 mg/L; 1.53 vs. 0.95; p < 0.001, respectively). Patients with low ZFP levels were characterized with lower ascites ZFP levels (0.25 vs. 16.4 ng/mL; p < 0.001) and ascites/serum index (0.011 vs. 0.462; p < 0.001). There were negative correlations between ascites ZFPs and platelet count (R = −0.497; p < 0.01) and positive correlation with INR (R = 0.640; p < 0.001). ZFP index positively correlated with platelet count (R = 0.726; p < 0.001) and negatively with INR (R = −0.392; p = 0.06). CONCLUSIONS: Decrease serum ZFP levels seem to reflect their decreased liver synthesis but not increased gut permeability in patients with liver cirrhosis. The physiologically low level of ZFPs in transudate is increased in exudate. Hindawi 2019-11-05 /pmc/articles/PMC6875214/ /pubmed/31781297 http://dx.doi.org/10.1155/2019/2804091 Text en Copyright © 2019 Marta Pietrukaniec et al. http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Article
Pietrukaniec, Marta
Migacz, Maciej
Żak-Gołąb, Agnieszka
Olszanecka-Glinianowicz, Magdalena
Chudek, Jerzy
Duława, Jan
Holecki, Michał
Zonulin Family Peptide Levels in Ascites and Serum in Patients with Liver Cirrhosis: A Preliminary Study
title Zonulin Family Peptide Levels in Ascites and Serum in Patients with Liver Cirrhosis: A Preliminary Study
title_full Zonulin Family Peptide Levels in Ascites and Serum in Patients with Liver Cirrhosis: A Preliminary Study
title_fullStr Zonulin Family Peptide Levels in Ascites and Serum in Patients with Liver Cirrhosis: A Preliminary Study
title_full_unstemmed Zonulin Family Peptide Levels in Ascites and Serum in Patients with Liver Cirrhosis: A Preliminary Study
title_short Zonulin Family Peptide Levels in Ascites and Serum in Patients with Liver Cirrhosis: A Preliminary Study
title_sort zonulin family peptide levels in ascites and serum in patients with liver cirrhosis: a preliminary study
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6875214/
https://www.ncbi.nlm.nih.gov/pubmed/31781297
http://dx.doi.org/10.1155/2019/2804091
work_keys_str_mv AT pietrukaniecmarta zonulinfamilypeptidelevelsinascitesandseruminpatientswithlivercirrhosisapreliminarystudy
AT migaczmaciej zonulinfamilypeptidelevelsinascitesandseruminpatientswithlivercirrhosisapreliminarystudy
AT zakgołabagnieszka zonulinfamilypeptidelevelsinascitesandseruminpatientswithlivercirrhosisapreliminarystudy
AT olszaneckaglinianowiczmagdalena zonulinfamilypeptidelevelsinascitesandseruminpatientswithlivercirrhosisapreliminarystudy
AT chudekjerzy zonulinfamilypeptidelevelsinascitesandseruminpatientswithlivercirrhosisapreliminarystudy
AT duławajan zonulinfamilypeptidelevelsinascitesandseruminpatientswithlivercirrhosisapreliminarystudy
AT holeckimichał zonulinfamilypeptidelevelsinascitesandseruminpatientswithlivercirrhosisapreliminarystudy