Cargando…
Comparison of second-line therapy in IVIg-refractory Kawasaki disease: a systematic review
BACKGROUND: Evidence remains contradictory regarding second-line therapy in patients with Kawasaki disease (KD) refractory to initial intravenous immunoglobulin (IVIg). The objective of this study aims to evaluate the efficacy and safety of three treatments [i.e. a second IVIg infusion, methylpredni...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6882052/ https://www.ncbi.nlm.nih.gov/pubmed/31775898 http://dx.doi.org/10.1186/s12969-019-0380-z |
_version_ | 1783474071517790208 |
---|---|
author | Crayne, Courtney B. Mitchell, Chace Beukelman, Timothy |
author_facet | Crayne, Courtney B. Mitchell, Chace Beukelman, Timothy |
author_sort | Crayne, Courtney B. |
collection | PubMed |
description | BACKGROUND: Evidence remains contradictory regarding second-line therapy in patients with Kawasaki disease (KD) refractory to initial intravenous immunoglobulin (IVIg). The objective of this study aims to evaluate the efficacy and safety of three treatments [i.e. a second IVIg infusion, methylprednisolone (IVMP), and infliximab (IFX)] in patients with refractory KD. METHODS: A systematic search of PubMed, Embase, Cochrane, and ClinicalTrials.gov using predefined MeSH terms was performed from 1990 through 2017. Relevance screening was performed by two independent reviewers. Inclusion criteria included English-only, original clinical data. Eight studies met the inclusion criteria. Fever resolution, coronary lesions, and adverse event outcomes were extracted and pooled for analysis. RESULTS: Of the 388 patients included from the 8 studies analyzed, a majority received a second IVIg dose (n = 263, 68%). Fever resolution was comparable between IVIg (72%) and IVMP (73%). IFX (88%) significantly increased fever resolution by approximately 20% compared to IVIg re-dose (RR 1.2; [95% CI: 1.1–1.4]; p = 0.03) and IVMP (RR 1.2; [95% CI: 1.0–1.5]; p = 0.04). Clinical significance of differences in coronary outcomes remains unclear. CONCLUSIONS: This combined analysis was limited due to variability in design and data reporting methods between the studies and risk of bias. In the absence of a clinical trial, IFX monotherapy as second-line treatment should be considered in patients who fail to respond to initial IVIg. This conclusion is based on a systematic review of the literature with pooled outcome data analysis suggesting IFX is more effective in fever resolution compared to a second IVIg dose and IVMP. |
format | Online Article Text |
id | pubmed-6882052 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-68820522019-12-03 Comparison of second-line therapy in IVIg-refractory Kawasaki disease: a systematic review Crayne, Courtney B. Mitchell, Chace Beukelman, Timothy Pediatr Rheumatol Online J Research Article BACKGROUND: Evidence remains contradictory regarding second-line therapy in patients with Kawasaki disease (KD) refractory to initial intravenous immunoglobulin (IVIg). The objective of this study aims to evaluate the efficacy and safety of three treatments [i.e. a second IVIg infusion, methylprednisolone (IVMP), and infliximab (IFX)] in patients with refractory KD. METHODS: A systematic search of PubMed, Embase, Cochrane, and ClinicalTrials.gov using predefined MeSH terms was performed from 1990 through 2017. Relevance screening was performed by two independent reviewers. Inclusion criteria included English-only, original clinical data. Eight studies met the inclusion criteria. Fever resolution, coronary lesions, and adverse event outcomes were extracted and pooled for analysis. RESULTS: Of the 388 patients included from the 8 studies analyzed, a majority received a second IVIg dose (n = 263, 68%). Fever resolution was comparable between IVIg (72%) and IVMP (73%). IFX (88%) significantly increased fever resolution by approximately 20% compared to IVIg re-dose (RR 1.2; [95% CI: 1.1–1.4]; p = 0.03) and IVMP (RR 1.2; [95% CI: 1.0–1.5]; p = 0.04). Clinical significance of differences in coronary outcomes remains unclear. CONCLUSIONS: This combined analysis was limited due to variability in design and data reporting methods between the studies and risk of bias. In the absence of a clinical trial, IFX monotherapy as second-line treatment should be considered in patients who fail to respond to initial IVIg. This conclusion is based on a systematic review of the literature with pooled outcome data analysis suggesting IFX is more effective in fever resolution compared to a second IVIg dose and IVMP. BioMed Central 2019-11-27 /pmc/articles/PMC6882052/ /pubmed/31775898 http://dx.doi.org/10.1186/s12969-019-0380-z Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Crayne, Courtney B. Mitchell, Chace Beukelman, Timothy Comparison of second-line therapy in IVIg-refractory Kawasaki disease: a systematic review |
title | Comparison of second-line therapy in IVIg-refractory Kawasaki disease: a systematic review |
title_full | Comparison of second-line therapy in IVIg-refractory Kawasaki disease: a systematic review |
title_fullStr | Comparison of second-line therapy in IVIg-refractory Kawasaki disease: a systematic review |
title_full_unstemmed | Comparison of second-line therapy in IVIg-refractory Kawasaki disease: a systematic review |
title_short | Comparison of second-line therapy in IVIg-refractory Kawasaki disease: a systematic review |
title_sort | comparison of second-line therapy in ivig-refractory kawasaki disease: a systematic review |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6882052/ https://www.ncbi.nlm.nih.gov/pubmed/31775898 http://dx.doi.org/10.1186/s12969-019-0380-z |
work_keys_str_mv | AT craynecourtneyb comparisonofsecondlinetherapyinivigrefractorykawasakidiseaseasystematicreview AT mitchellchace comparisonofsecondlinetherapyinivigrefractorykawasakidiseaseasystematicreview AT beukelmantimothy comparisonofsecondlinetherapyinivigrefractorykawasakidiseaseasystematicreview |