Cargando…

Tumour location and efficacy of first-line EGFR inhibitors in KRAS/RAS wild-type metastatic colorectal cancer: retrospective analyses of two phase II randomised Spanish TTD trials

PURPOSE: Metastatic colorectal cancer (mCRC) is a group of distinct diseases, with clinical and molecular differences between right-sided and left-sided tumours driving varying prognosis. METHODS: Patients with KRAS/RAS-wild type (wt) mCRC treated in first line with epidermal growth factor receptor...

Descripción completa

Detalles Bibliográficos
Autores principales: Benavides, Manuel, Díaz-Rubio, Eduardo, Carrato, Alfredo, Abad, Albert, Guillén, Carmen, Garcia-Alfonso, Pilar, Gil, Silvia, Cano, María Teresa, Safont, María José, Gravalos, Cristina, Manzano, José Luis, Sánchez, Antonio, Alcaide, Julia, López, Rafael, Massutí, Bartomeu, Sastre, Javier, Martínez, Eva, Escudero, Pilar, Méndez, Miguel, Aranda, Enrique
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BMJ Publishing Group 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6890384/
https://www.ncbi.nlm.nih.gov/pubmed/31803504
http://dx.doi.org/10.1136/esmoopen-2019-000599
_version_ 1783475602630639616
author Benavides, Manuel
Díaz-Rubio, Eduardo
Carrato, Alfredo
Abad, Albert
Guillén, Carmen
Garcia-Alfonso, Pilar
Gil, Silvia
Cano, María Teresa
Safont, María José
Gravalos, Cristina
Manzano, José Luis
Sánchez, Antonio
Alcaide, Julia
López, Rafael
Massutí, Bartomeu
Sastre, Javier
Martínez, Eva
Escudero, Pilar
Méndez, Miguel
Aranda, Enrique
author_facet Benavides, Manuel
Díaz-Rubio, Eduardo
Carrato, Alfredo
Abad, Albert
Guillén, Carmen
Garcia-Alfonso, Pilar
Gil, Silvia
Cano, María Teresa
Safont, María José
Gravalos, Cristina
Manzano, José Luis
Sánchez, Antonio
Alcaide, Julia
López, Rafael
Massutí, Bartomeu
Sastre, Javier
Martínez, Eva
Escudero, Pilar
Méndez, Miguel
Aranda, Enrique
author_sort Benavides, Manuel
collection PubMed
description PURPOSE: Metastatic colorectal cancer (mCRC) is a group of distinct diseases, with clinical and molecular differences between right-sided and left-sided tumours driving varying prognosis. METHODS: Patients with KRAS/RAS-wild type (wt) mCRC treated in first line with epidermal growth factor receptor inhibitors (EGFR-Is) (cetuximab or panitumumab) plus oxaliplatin or irinotecan-based chemotherapy from two phase II randomised trials conducted by the Spanish Cooperative for the Treatment of Digestive Tumours group were included in this retrospective study. The main objective was to analyse the prognostic effect of primary tumour location on objective response rate (ORR), progression-free survival (PFS) and overall survival (OS). RESULTS: Patients with KRAS-wt right-sided tumours (n=52) had significantly lower efficacy as compared with patients with KRAS-wt left-sided tumours (n=209); confirmed ORR (25% vs 47%, respectively; OR 0.4, 95% CI 0.2 to 0.8, p=0.004); and shorter median PFS (7.2 vs 9.9 months; HR 0.6, 95% CI 0.4 to 0.9, p=0.0157) and OS (13.6 vs 27.7 months; HR 0.5, 95% CI 0.3 to 0.7, p<0.0001). Similar results were observed in the RAS-wt populations. The further classification of left-sided tumours as colon or rectum delivered similar survival outcomes, as well as a tendency to diminished ORR in patients with rectum tumours. CONCLUSION: We observed significantly improved efficacy outcomes in patients with KRAS/RAS-wt mCRC treated with first-line EGFR-I plus chemotherapy in left-sided primary tumours as compared with right-sided primary tumours. TRIAL REGISTRATION NUMBERS: NCT01161316 and NCT00885885.
format Online
Article
Text
id pubmed-6890384
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BMJ Publishing Group
record_format MEDLINE/PubMed
spelling pubmed-68903842019-12-04 Tumour location and efficacy of first-line EGFR inhibitors in KRAS/RAS wild-type metastatic colorectal cancer: retrospective analyses of two phase II randomised Spanish TTD trials Benavides, Manuel Díaz-Rubio, Eduardo Carrato, Alfredo Abad, Albert Guillén, Carmen Garcia-Alfonso, Pilar Gil, Silvia Cano, María Teresa Safont, María José Gravalos, Cristina Manzano, José Luis Sánchez, Antonio Alcaide, Julia López, Rafael Massutí, Bartomeu Sastre, Javier Martínez, Eva Escudero, Pilar Méndez, Miguel Aranda, Enrique ESMO Open Original Research PURPOSE: Metastatic colorectal cancer (mCRC) is a group of distinct diseases, with clinical and molecular differences between right-sided and left-sided tumours driving varying prognosis. METHODS: Patients with KRAS/RAS-wild type (wt) mCRC treated in first line with epidermal growth factor receptor inhibitors (EGFR-Is) (cetuximab or panitumumab) plus oxaliplatin or irinotecan-based chemotherapy from two phase II randomised trials conducted by the Spanish Cooperative for the Treatment of Digestive Tumours group were included in this retrospective study. The main objective was to analyse the prognostic effect of primary tumour location on objective response rate (ORR), progression-free survival (PFS) and overall survival (OS). RESULTS: Patients with KRAS-wt right-sided tumours (n=52) had significantly lower efficacy as compared with patients with KRAS-wt left-sided tumours (n=209); confirmed ORR (25% vs 47%, respectively; OR 0.4, 95% CI 0.2 to 0.8, p=0.004); and shorter median PFS (7.2 vs 9.9 months; HR 0.6, 95% CI 0.4 to 0.9, p=0.0157) and OS (13.6 vs 27.7 months; HR 0.5, 95% CI 0.3 to 0.7, p<0.0001). Similar results were observed in the RAS-wt populations. The further classification of left-sided tumours as colon or rectum delivered similar survival outcomes, as well as a tendency to diminished ORR in patients with rectum tumours. CONCLUSION: We observed significantly improved efficacy outcomes in patients with KRAS/RAS-wt mCRC treated with first-line EGFR-I plus chemotherapy in left-sided primary tumours as compared with right-sided primary tumours. TRIAL REGISTRATION NUMBERS: NCT01161316 and NCT00885885. BMJ Publishing Group 2019-12-01 /pmc/articles/PMC6890384/ /pubmed/31803504 http://dx.doi.org/10.1136/esmoopen-2019-000599 Text en © Author (s) (or their employer(s)) 2019. Re-use permitted under CC BY-NC. No commercial re-use. Published by BMJ on behalf of the European Society for Medical Oncology. This is an open access article distributed in accordance with the Creative Commons Attribution Non Commercial (CC BY-NC 4.0) license, which permits others to distribute, remix, adapt, build upon this work non-commercially, and license their derivative works on different terms, provided the original work is properly cited, any changes made are indicated, and the use is non-commercial. See: http://creativecommons.org/licenses/by-nc/4.0/.
spellingShingle Original Research
Benavides, Manuel
Díaz-Rubio, Eduardo
Carrato, Alfredo
Abad, Albert
Guillén, Carmen
Garcia-Alfonso, Pilar
Gil, Silvia
Cano, María Teresa
Safont, María José
Gravalos, Cristina
Manzano, José Luis
Sánchez, Antonio
Alcaide, Julia
López, Rafael
Massutí, Bartomeu
Sastre, Javier
Martínez, Eva
Escudero, Pilar
Méndez, Miguel
Aranda, Enrique
Tumour location and efficacy of first-line EGFR inhibitors in KRAS/RAS wild-type metastatic colorectal cancer: retrospective analyses of two phase II randomised Spanish TTD trials
title Tumour location and efficacy of first-line EGFR inhibitors in KRAS/RAS wild-type metastatic colorectal cancer: retrospective analyses of two phase II randomised Spanish TTD trials
title_full Tumour location and efficacy of first-line EGFR inhibitors in KRAS/RAS wild-type metastatic colorectal cancer: retrospective analyses of two phase II randomised Spanish TTD trials
title_fullStr Tumour location and efficacy of first-line EGFR inhibitors in KRAS/RAS wild-type metastatic colorectal cancer: retrospective analyses of two phase II randomised Spanish TTD trials
title_full_unstemmed Tumour location and efficacy of first-line EGFR inhibitors in KRAS/RAS wild-type metastatic colorectal cancer: retrospective analyses of two phase II randomised Spanish TTD trials
title_short Tumour location and efficacy of first-line EGFR inhibitors in KRAS/RAS wild-type metastatic colorectal cancer: retrospective analyses of two phase II randomised Spanish TTD trials
title_sort tumour location and efficacy of first-line egfr inhibitors in kras/ras wild-type metastatic colorectal cancer: retrospective analyses of two phase ii randomised spanish ttd trials
topic Original Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6890384/
https://www.ncbi.nlm.nih.gov/pubmed/31803504
http://dx.doi.org/10.1136/esmoopen-2019-000599
work_keys_str_mv AT benavidesmanuel tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials
AT diazrubioeduardo tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials
AT carratoalfredo tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials
AT abadalbert tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials
AT guillencarmen tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials
AT garciaalfonsopilar tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials
AT gilsilvia tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials
AT canomariateresa tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials
AT safontmariajose tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials
AT gravaloscristina tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials
AT manzanojoseluis tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials
AT sanchezantonio tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials
AT alcaidejulia tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials
AT lopezrafael tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials
AT massutibartomeu tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials
AT sastrejavier tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials
AT martinezeva tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials
AT escuderopilar tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials
AT mendezmiguel tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials
AT arandaenrique tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials
AT tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials