Cargando…
Tumour location and efficacy of first-line EGFR inhibitors in KRAS/RAS wild-type metastatic colorectal cancer: retrospective analyses of two phase II randomised Spanish TTD trials
PURPOSE: Metastatic colorectal cancer (mCRC) is a group of distinct diseases, with clinical and molecular differences between right-sided and left-sided tumours driving varying prognosis. METHODS: Patients with KRAS/RAS-wild type (wt) mCRC treated in first line with epidermal growth factor receptor...
Autores principales: | , , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BMJ Publishing Group
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6890384/ https://www.ncbi.nlm.nih.gov/pubmed/31803504 http://dx.doi.org/10.1136/esmoopen-2019-000599 |
_version_ | 1783475602630639616 |
---|---|
author | Benavides, Manuel Díaz-Rubio, Eduardo Carrato, Alfredo Abad, Albert Guillén, Carmen Garcia-Alfonso, Pilar Gil, Silvia Cano, María Teresa Safont, María José Gravalos, Cristina Manzano, José Luis Sánchez, Antonio Alcaide, Julia López, Rafael Massutí, Bartomeu Sastre, Javier Martínez, Eva Escudero, Pilar Méndez, Miguel Aranda, Enrique |
author_facet | Benavides, Manuel Díaz-Rubio, Eduardo Carrato, Alfredo Abad, Albert Guillén, Carmen Garcia-Alfonso, Pilar Gil, Silvia Cano, María Teresa Safont, María José Gravalos, Cristina Manzano, José Luis Sánchez, Antonio Alcaide, Julia López, Rafael Massutí, Bartomeu Sastre, Javier Martínez, Eva Escudero, Pilar Méndez, Miguel Aranda, Enrique |
author_sort | Benavides, Manuel |
collection | PubMed |
description | PURPOSE: Metastatic colorectal cancer (mCRC) is a group of distinct diseases, with clinical and molecular differences between right-sided and left-sided tumours driving varying prognosis. METHODS: Patients with KRAS/RAS-wild type (wt) mCRC treated in first line with epidermal growth factor receptor inhibitors (EGFR-Is) (cetuximab or panitumumab) plus oxaliplatin or irinotecan-based chemotherapy from two phase II randomised trials conducted by the Spanish Cooperative for the Treatment of Digestive Tumours group were included in this retrospective study. The main objective was to analyse the prognostic effect of primary tumour location on objective response rate (ORR), progression-free survival (PFS) and overall survival (OS). RESULTS: Patients with KRAS-wt right-sided tumours (n=52) had significantly lower efficacy as compared with patients with KRAS-wt left-sided tumours (n=209); confirmed ORR (25% vs 47%, respectively; OR 0.4, 95% CI 0.2 to 0.8, p=0.004); and shorter median PFS (7.2 vs 9.9 months; HR 0.6, 95% CI 0.4 to 0.9, p=0.0157) and OS (13.6 vs 27.7 months; HR 0.5, 95% CI 0.3 to 0.7, p<0.0001). Similar results were observed in the RAS-wt populations. The further classification of left-sided tumours as colon or rectum delivered similar survival outcomes, as well as a tendency to diminished ORR in patients with rectum tumours. CONCLUSION: We observed significantly improved efficacy outcomes in patients with KRAS/RAS-wt mCRC treated with first-line EGFR-I plus chemotherapy in left-sided primary tumours as compared with right-sided primary tumours. TRIAL REGISTRATION NUMBERS: NCT01161316 and NCT00885885. |
format | Online Article Text |
id | pubmed-6890384 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BMJ Publishing Group |
record_format | MEDLINE/PubMed |
spelling | pubmed-68903842019-12-04 Tumour location and efficacy of first-line EGFR inhibitors in KRAS/RAS wild-type metastatic colorectal cancer: retrospective analyses of two phase II randomised Spanish TTD trials Benavides, Manuel Díaz-Rubio, Eduardo Carrato, Alfredo Abad, Albert Guillén, Carmen Garcia-Alfonso, Pilar Gil, Silvia Cano, María Teresa Safont, María José Gravalos, Cristina Manzano, José Luis Sánchez, Antonio Alcaide, Julia López, Rafael Massutí, Bartomeu Sastre, Javier Martínez, Eva Escudero, Pilar Méndez, Miguel Aranda, Enrique ESMO Open Original Research PURPOSE: Metastatic colorectal cancer (mCRC) is a group of distinct diseases, with clinical and molecular differences between right-sided and left-sided tumours driving varying prognosis. METHODS: Patients with KRAS/RAS-wild type (wt) mCRC treated in first line with epidermal growth factor receptor inhibitors (EGFR-Is) (cetuximab or panitumumab) plus oxaliplatin or irinotecan-based chemotherapy from two phase II randomised trials conducted by the Spanish Cooperative for the Treatment of Digestive Tumours group were included in this retrospective study. The main objective was to analyse the prognostic effect of primary tumour location on objective response rate (ORR), progression-free survival (PFS) and overall survival (OS). RESULTS: Patients with KRAS-wt right-sided tumours (n=52) had significantly lower efficacy as compared with patients with KRAS-wt left-sided tumours (n=209); confirmed ORR (25% vs 47%, respectively; OR 0.4, 95% CI 0.2 to 0.8, p=0.004); and shorter median PFS (7.2 vs 9.9 months; HR 0.6, 95% CI 0.4 to 0.9, p=0.0157) and OS (13.6 vs 27.7 months; HR 0.5, 95% CI 0.3 to 0.7, p<0.0001). Similar results were observed in the RAS-wt populations. The further classification of left-sided tumours as colon or rectum delivered similar survival outcomes, as well as a tendency to diminished ORR in patients with rectum tumours. CONCLUSION: We observed significantly improved efficacy outcomes in patients with KRAS/RAS-wt mCRC treated with first-line EGFR-I plus chemotherapy in left-sided primary tumours as compared with right-sided primary tumours. TRIAL REGISTRATION NUMBERS: NCT01161316 and NCT00885885. BMJ Publishing Group 2019-12-01 /pmc/articles/PMC6890384/ /pubmed/31803504 http://dx.doi.org/10.1136/esmoopen-2019-000599 Text en © Author (s) (or their employer(s)) 2019. Re-use permitted under CC BY-NC. No commercial re-use. Published by BMJ on behalf of the European Society for Medical Oncology. This is an open access article distributed in accordance with the Creative Commons Attribution Non Commercial (CC BY-NC 4.0) license, which permits others to distribute, remix, adapt, build upon this work non-commercially, and license their derivative works on different terms, provided the original work is properly cited, any changes made are indicated, and the use is non-commercial. See: http://creativecommons.org/licenses/by-nc/4.0/. |
spellingShingle | Original Research Benavides, Manuel Díaz-Rubio, Eduardo Carrato, Alfredo Abad, Albert Guillén, Carmen Garcia-Alfonso, Pilar Gil, Silvia Cano, María Teresa Safont, María José Gravalos, Cristina Manzano, José Luis Sánchez, Antonio Alcaide, Julia López, Rafael Massutí, Bartomeu Sastre, Javier Martínez, Eva Escudero, Pilar Méndez, Miguel Aranda, Enrique Tumour location and efficacy of first-line EGFR inhibitors in KRAS/RAS wild-type metastatic colorectal cancer: retrospective analyses of two phase II randomised Spanish TTD trials |
title | Tumour location and efficacy of first-line EGFR inhibitors in KRAS/RAS wild-type metastatic colorectal cancer: retrospective analyses of two phase II randomised Spanish TTD trials |
title_full | Tumour location and efficacy of first-line EGFR inhibitors in KRAS/RAS wild-type metastatic colorectal cancer: retrospective analyses of two phase II randomised Spanish TTD trials |
title_fullStr | Tumour location and efficacy of first-line EGFR inhibitors in KRAS/RAS wild-type metastatic colorectal cancer: retrospective analyses of two phase II randomised Spanish TTD trials |
title_full_unstemmed | Tumour location and efficacy of first-line EGFR inhibitors in KRAS/RAS wild-type metastatic colorectal cancer: retrospective analyses of two phase II randomised Spanish TTD trials |
title_short | Tumour location and efficacy of first-line EGFR inhibitors in KRAS/RAS wild-type metastatic colorectal cancer: retrospective analyses of two phase II randomised Spanish TTD trials |
title_sort | tumour location and efficacy of first-line egfr inhibitors in kras/ras wild-type metastatic colorectal cancer: retrospective analyses of two phase ii randomised spanish ttd trials |
topic | Original Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6890384/ https://www.ncbi.nlm.nih.gov/pubmed/31803504 http://dx.doi.org/10.1136/esmoopen-2019-000599 |
work_keys_str_mv | AT benavidesmanuel tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials AT diazrubioeduardo tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials AT carratoalfredo tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials AT abadalbert tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials AT guillencarmen tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials AT garciaalfonsopilar tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials AT gilsilvia tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials AT canomariateresa tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials AT safontmariajose tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials AT gravaloscristina tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials AT manzanojoseluis tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials AT sanchezantonio tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials AT alcaidejulia tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials AT lopezrafael tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials AT massutibartomeu tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials AT sastrejavier tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials AT martinezeva tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials AT escuderopilar tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials AT mendezmiguel tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials AT arandaenrique tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials AT tumourlocationandefficacyoffirstlineegfrinhibitorsinkrasraswildtypemetastaticcolorectalcancerretrospectiveanalysesoftwophaseiirandomisedspanishttdtrials |