Cargando…

The role of primary healthcare physicians in violence against Women intervention program in Indonesia

BACKGROUND: Violence against women (VAW) has many impacts on health, but the role of the primary healthcare physicians in the intervention program is lacking. This research aimed to explore the primary healthcare physician role in a comprehensive intervention program of VAW in Malang City, Indonesia...

Descripción completa

Detalles Bibliográficos
Autores principales: Purwaningtyas, Nuretha Hevy, Wiwaha, Guswan, Setiawati, Elsa Pudji, Arya, Insi Farisa Desy
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6892181/
https://www.ncbi.nlm.nih.gov/pubmed/31801466
http://dx.doi.org/10.1186/s12875-019-1054-0
_version_ 1783475979073617920
author Purwaningtyas, Nuretha Hevy
Wiwaha, Guswan
Setiawati, Elsa Pudji
Arya, Insi Farisa Desy
author_facet Purwaningtyas, Nuretha Hevy
Wiwaha, Guswan
Setiawati, Elsa Pudji
Arya, Insi Farisa Desy
author_sort Purwaningtyas, Nuretha Hevy
collection PubMed
description BACKGROUND: Violence against women (VAW) has many impacts on health, but the role of the primary healthcare physicians in the intervention program is lacking. This research aimed to explore the primary healthcare physician role in a comprehensive intervention program of VAW in Malang City, Indonesia. METHODS: This qualitative research was conducted using a phenomenology approach. A focused group discussion followed by in-depth interviews were carried out involving six primary healthcare physicians in Puskesmas (Primary Healthcare Center) and two stakeholders. Legal document related to VAW was reviewed to measure up the role of the primary healthcare physicians. RESULT: Our study revealed that the role of physicians in primary healthcare centers on the VAW intervention program was limited. This was due to the insufficient knowledge of the physicians on the VAW program, physicians’ constraint on counseling skill, unsupportive infrastructure, and a limited number of physicians in Puskesmas. Some barriers related to the VAW program management were also discovered and needed intervention at the decision-maker level. CONCLUSION: The role of primary healthcare physicians in the comprehensive intervention of the VAW program is not optimum. The source of the problem involves the physician capability and program management aspects in all levels of decision-makers. Local government awareness and commitment are needed to improve the overall management of the VAW intervention program in this city.
format Online
Article
Text
id pubmed-6892181
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-68921812019-12-11 The role of primary healthcare physicians in violence against Women intervention program in Indonesia Purwaningtyas, Nuretha Hevy Wiwaha, Guswan Setiawati, Elsa Pudji Arya, Insi Farisa Desy BMC Fam Pract Research Article BACKGROUND: Violence against women (VAW) has many impacts on health, but the role of the primary healthcare physicians in the intervention program is lacking. This research aimed to explore the primary healthcare physician role in a comprehensive intervention program of VAW in Malang City, Indonesia. METHODS: This qualitative research was conducted using a phenomenology approach. A focused group discussion followed by in-depth interviews were carried out involving six primary healthcare physicians in Puskesmas (Primary Healthcare Center) and two stakeholders. Legal document related to VAW was reviewed to measure up the role of the primary healthcare physicians. RESULT: Our study revealed that the role of physicians in primary healthcare centers on the VAW intervention program was limited. This was due to the insufficient knowledge of the physicians on the VAW program, physicians’ constraint on counseling skill, unsupportive infrastructure, and a limited number of physicians in Puskesmas. Some barriers related to the VAW program management were also discovered and needed intervention at the decision-maker level. CONCLUSION: The role of primary healthcare physicians in the comprehensive intervention of the VAW program is not optimum. The source of the problem involves the physician capability and program management aspects in all levels of decision-makers. Local government awareness and commitment are needed to improve the overall management of the VAW intervention program in this city. BioMed Central 2019-12-04 /pmc/articles/PMC6892181/ /pubmed/31801466 http://dx.doi.org/10.1186/s12875-019-1054-0 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Purwaningtyas, Nuretha Hevy
Wiwaha, Guswan
Setiawati, Elsa Pudji
Arya, Insi Farisa Desy
The role of primary healthcare physicians in violence against Women intervention program in Indonesia
title The role of primary healthcare physicians in violence against Women intervention program in Indonesia
title_full The role of primary healthcare physicians in violence against Women intervention program in Indonesia
title_fullStr The role of primary healthcare physicians in violence against Women intervention program in Indonesia
title_full_unstemmed The role of primary healthcare physicians in violence against Women intervention program in Indonesia
title_short The role of primary healthcare physicians in violence against Women intervention program in Indonesia
title_sort role of primary healthcare physicians in violence against women intervention program in indonesia
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6892181/
https://www.ncbi.nlm.nih.gov/pubmed/31801466
http://dx.doi.org/10.1186/s12875-019-1054-0
work_keys_str_mv AT purwaningtyasnurethahevy theroleofprimaryhealthcarephysiciansinviolenceagainstwomeninterventionprograminindonesia
AT wiwahaguswan theroleofprimaryhealthcarephysiciansinviolenceagainstwomeninterventionprograminindonesia
AT setiawatielsapudji theroleofprimaryhealthcarephysiciansinviolenceagainstwomeninterventionprograminindonesia
AT aryainsifarisadesy theroleofprimaryhealthcarephysiciansinviolenceagainstwomeninterventionprograminindonesia
AT purwaningtyasnurethahevy roleofprimaryhealthcarephysiciansinviolenceagainstwomeninterventionprograminindonesia
AT wiwahaguswan roleofprimaryhealthcarephysiciansinviolenceagainstwomeninterventionprograminindonesia
AT setiawatielsapudji roleofprimaryhealthcarephysiciansinviolenceagainstwomeninterventionprograminindonesia
AT aryainsifarisadesy roleofprimaryhealthcarephysiciansinviolenceagainstwomeninterventionprograminindonesia