Cargando…
The role of primary healthcare physicians in violence against Women intervention program in Indonesia
BACKGROUND: Violence against women (VAW) has many impacts on health, but the role of the primary healthcare physicians in the intervention program is lacking. This research aimed to explore the primary healthcare physician role in a comprehensive intervention program of VAW in Malang City, Indonesia...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6892181/ https://www.ncbi.nlm.nih.gov/pubmed/31801466 http://dx.doi.org/10.1186/s12875-019-1054-0 |
_version_ | 1783475979073617920 |
---|---|
author | Purwaningtyas, Nuretha Hevy Wiwaha, Guswan Setiawati, Elsa Pudji Arya, Insi Farisa Desy |
author_facet | Purwaningtyas, Nuretha Hevy Wiwaha, Guswan Setiawati, Elsa Pudji Arya, Insi Farisa Desy |
author_sort | Purwaningtyas, Nuretha Hevy |
collection | PubMed |
description | BACKGROUND: Violence against women (VAW) has many impacts on health, but the role of the primary healthcare physicians in the intervention program is lacking. This research aimed to explore the primary healthcare physician role in a comprehensive intervention program of VAW in Malang City, Indonesia. METHODS: This qualitative research was conducted using a phenomenology approach. A focused group discussion followed by in-depth interviews were carried out involving six primary healthcare physicians in Puskesmas (Primary Healthcare Center) and two stakeholders. Legal document related to VAW was reviewed to measure up the role of the primary healthcare physicians. RESULT: Our study revealed that the role of physicians in primary healthcare centers on the VAW intervention program was limited. This was due to the insufficient knowledge of the physicians on the VAW program, physicians’ constraint on counseling skill, unsupportive infrastructure, and a limited number of physicians in Puskesmas. Some barriers related to the VAW program management were also discovered and needed intervention at the decision-maker level. CONCLUSION: The role of primary healthcare physicians in the comprehensive intervention of the VAW program is not optimum. The source of the problem involves the physician capability and program management aspects in all levels of decision-makers. Local government awareness and commitment are needed to improve the overall management of the VAW intervention program in this city. |
format | Online Article Text |
id | pubmed-6892181 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-68921812019-12-11 The role of primary healthcare physicians in violence against Women intervention program in Indonesia Purwaningtyas, Nuretha Hevy Wiwaha, Guswan Setiawati, Elsa Pudji Arya, Insi Farisa Desy BMC Fam Pract Research Article BACKGROUND: Violence against women (VAW) has many impacts on health, but the role of the primary healthcare physicians in the intervention program is lacking. This research aimed to explore the primary healthcare physician role in a comprehensive intervention program of VAW in Malang City, Indonesia. METHODS: This qualitative research was conducted using a phenomenology approach. A focused group discussion followed by in-depth interviews were carried out involving six primary healthcare physicians in Puskesmas (Primary Healthcare Center) and two stakeholders. Legal document related to VAW was reviewed to measure up the role of the primary healthcare physicians. RESULT: Our study revealed that the role of physicians in primary healthcare centers on the VAW intervention program was limited. This was due to the insufficient knowledge of the physicians on the VAW program, physicians’ constraint on counseling skill, unsupportive infrastructure, and a limited number of physicians in Puskesmas. Some barriers related to the VAW program management were also discovered and needed intervention at the decision-maker level. CONCLUSION: The role of primary healthcare physicians in the comprehensive intervention of the VAW program is not optimum. The source of the problem involves the physician capability and program management aspects in all levels of decision-makers. Local government awareness and commitment are needed to improve the overall management of the VAW intervention program in this city. BioMed Central 2019-12-04 /pmc/articles/PMC6892181/ /pubmed/31801466 http://dx.doi.org/10.1186/s12875-019-1054-0 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Purwaningtyas, Nuretha Hevy Wiwaha, Guswan Setiawati, Elsa Pudji Arya, Insi Farisa Desy The role of primary healthcare physicians in violence against Women intervention program in Indonesia |
title | The role of primary healthcare physicians in violence against Women intervention program in Indonesia |
title_full | The role of primary healthcare physicians in violence against Women intervention program in Indonesia |
title_fullStr | The role of primary healthcare physicians in violence against Women intervention program in Indonesia |
title_full_unstemmed | The role of primary healthcare physicians in violence against Women intervention program in Indonesia |
title_short | The role of primary healthcare physicians in violence against Women intervention program in Indonesia |
title_sort | role of primary healthcare physicians in violence against women intervention program in indonesia |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6892181/ https://www.ncbi.nlm.nih.gov/pubmed/31801466 http://dx.doi.org/10.1186/s12875-019-1054-0 |
work_keys_str_mv | AT purwaningtyasnurethahevy theroleofprimaryhealthcarephysiciansinviolenceagainstwomeninterventionprograminindonesia AT wiwahaguswan theroleofprimaryhealthcarephysiciansinviolenceagainstwomeninterventionprograminindonesia AT setiawatielsapudji theroleofprimaryhealthcarephysiciansinviolenceagainstwomeninterventionprograminindonesia AT aryainsifarisadesy theroleofprimaryhealthcarephysiciansinviolenceagainstwomeninterventionprograminindonesia AT purwaningtyasnurethahevy roleofprimaryhealthcarephysiciansinviolenceagainstwomeninterventionprograminindonesia AT wiwahaguswan roleofprimaryhealthcarephysiciansinviolenceagainstwomeninterventionprograminindonesia AT setiawatielsapudji roleofprimaryhealthcarephysiciansinviolenceagainstwomeninterventionprograminindonesia AT aryainsifarisadesy roleofprimaryhealthcarephysiciansinviolenceagainstwomeninterventionprograminindonesia |