Cargando…

Nurses’ perspectives on human rights when coercion is used in psychiatry: a systematic review protocol of qualitative evidence

BACKGROUND: The World Health Organization describes the perpetuation of human rights violations against people with mental health problems as a global emergency. Despite this observation, recent studies suggest that coercive measures, such as seclusion, restraints, involuntary hospitalization, or in...

Descripción completa

Detalles Bibliográficos
Autores principales: Pariseau-Legault, Pierre, Vallée-Ouimet, Sandrine, Goulet, Marie-Hélène, Jacob, Jean-Daniel
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6900841/
https://www.ncbi.nlm.nih.gov/pubmed/31815660
http://dx.doi.org/10.1186/s13643-019-1224-0
_version_ 1783477407355764736
author Pariseau-Legault, Pierre
Vallée-Ouimet, Sandrine
Goulet, Marie-Hélène
Jacob, Jean-Daniel
author_facet Pariseau-Legault, Pierre
Vallée-Ouimet, Sandrine
Goulet, Marie-Hélène
Jacob, Jean-Daniel
author_sort Pariseau-Legault, Pierre
collection PubMed
description BACKGROUND: The World Health Organization describes the perpetuation of human rights violations against people with mental health problems as a global emergency. Despite this observation, recent studies suggest that coercive measures, such as seclusion, restraints, involuntary hospitalization, or involuntary treatment, are steadily or increasingly being used without proof of their effectiveness. In nursing, several literature reviews have focused on understanding nurses’ perspectives on the use of seclusion and restraints. Although many studies describe the ethical dilemmas faced by nurses in this context, to this date, their perspectives on patient’s rights when a broad variety of coercive measures are used are not well understood. The aim of this review is to produce a qualitative synthesis of how human rights are actually integrated into psychiatric and mental health nursing practice in the context of coercive work. METHODS: Noblit and Hare’s meta-ethnographic approach will be used to conduct this systematic review. The search will be conducted in CINAHL, Medline, PsycINFO, ERIC, and Scopus databases, using the PICo model (Population, phenomenon of Interest, Context) and a combination of keywords and descriptors. It will be complemented by a manual search of non-indexed articles, gray literature, and other applicable data sources, such as human rights related documents. Qualitative and mixed-method study designs will be included in this review. Empirical and peer-reviewed articles published between 2008 and 2019 will be selected. Articles will be evaluated independently by two reviewers to determine their inclusion against eligibility criteria. The quality of the selected papers will then be independently evaluated by two reviewers, using the Joanna Briggs Institute’s Checklist for Qualitative Research. Data extraction and content analysis will focus on first- and second-order constructs, that is, the extraction of research participants’ narratives and their interpretation. DISCUSSION: This review will provide a synthesis of how psychiatric and mental health nurses integrate human rights principles into their practice, as well as it will identify research gaps in this area. The results of this review will then provide qualitative evidence to better understand how nurses can contribute to the recognition, protection, and advocate for human rights in a psychiatric context. SYSTEMATIC REVIEW REGISTRATION: PROSPERO, CRD42019116862
format Online
Article
Text
id pubmed-6900841
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-69008412019-12-11 Nurses’ perspectives on human rights when coercion is used in psychiatry: a systematic review protocol of qualitative evidence Pariseau-Legault, Pierre Vallée-Ouimet, Sandrine Goulet, Marie-Hélène Jacob, Jean-Daniel Syst Rev Protocol BACKGROUND: The World Health Organization describes the perpetuation of human rights violations against people with mental health problems as a global emergency. Despite this observation, recent studies suggest that coercive measures, such as seclusion, restraints, involuntary hospitalization, or involuntary treatment, are steadily or increasingly being used without proof of their effectiveness. In nursing, several literature reviews have focused on understanding nurses’ perspectives on the use of seclusion and restraints. Although many studies describe the ethical dilemmas faced by nurses in this context, to this date, their perspectives on patient’s rights when a broad variety of coercive measures are used are not well understood. The aim of this review is to produce a qualitative synthesis of how human rights are actually integrated into psychiatric and mental health nursing practice in the context of coercive work. METHODS: Noblit and Hare’s meta-ethnographic approach will be used to conduct this systematic review. The search will be conducted in CINAHL, Medline, PsycINFO, ERIC, and Scopus databases, using the PICo model (Population, phenomenon of Interest, Context) and a combination of keywords and descriptors. It will be complemented by a manual search of non-indexed articles, gray literature, and other applicable data sources, such as human rights related documents. Qualitative and mixed-method study designs will be included in this review. Empirical and peer-reviewed articles published between 2008 and 2019 will be selected. Articles will be evaluated independently by two reviewers to determine their inclusion against eligibility criteria. The quality of the selected papers will then be independently evaluated by two reviewers, using the Joanna Briggs Institute’s Checklist for Qualitative Research. Data extraction and content analysis will focus on first- and second-order constructs, that is, the extraction of research participants’ narratives and their interpretation. DISCUSSION: This review will provide a synthesis of how psychiatric and mental health nurses integrate human rights principles into their practice, as well as it will identify research gaps in this area. The results of this review will then provide qualitative evidence to better understand how nurses can contribute to the recognition, protection, and advocate for human rights in a psychiatric context. SYSTEMATIC REVIEW REGISTRATION: PROSPERO, CRD42019116862 BioMed Central 2019-12-09 /pmc/articles/PMC6900841/ /pubmed/31815660 http://dx.doi.org/10.1186/s13643-019-1224-0 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Protocol
Pariseau-Legault, Pierre
Vallée-Ouimet, Sandrine
Goulet, Marie-Hélène
Jacob, Jean-Daniel
Nurses’ perspectives on human rights when coercion is used in psychiatry: a systematic review protocol of qualitative evidence
title Nurses’ perspectives on human rights when coercion is used in psychiatry: a systematic review protocol of qualitative evidence
title_full Nurses’ perspectives on human rights when coercion is used in psychiatry: a systematic review protocol of qualitative evidence
title_fullStr Nurses’ perspectives on human rights when coercion is used in psychiatry: a systematic review protocol of qualitative evidence
title_full_unstemmed Nurses’ perspectives on human rights when coercion is used in psychiatry: a systematic review protocol of qualitative evidence
title_short Nurses’ perspectives on human rights when coercion is used in psychiatry: a systematic review protocol of qualitative evidence
title_sort nurses’ perspectives on human rights when coercion is used in psychiatry: a systematic review protocol of qualitative evidence
topic Protocol
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6900841/
https://www.ncbi.nlm.nih.gov/pubmed/31815660
http://dx.doi.org/10.1186/s13643-019-1224-0
work_keys_str_mv AT pariseaulegaultpierre nursesperspectivesonhumanrightswhencoercionisusedinpsychiatryasystematicreviewprotocolofqualitativeevidence
AT valleeouimetsandrine nursesperspectivesonhumanrightswhencoercionisusedinpsychiatryasystematicreviewprotocolofqualitativeevidence
AT gouletmariehelene nursesperspectivesonhumanrightswhencoercionisusedinpsychiatryasystematicreviewprotocolofqualitativeevidence
AT jacobjeandaniel nursesperspectivesonhumanrightswhencoercionisusedinpsychiatryasystematicreviewprotocolofqualitativeevidence